PDB entry 4fgw

View 4fgw on RCSB PDB site
Description: Structure of Glycerol-3-Phosphate Dehydrogenase, GPD1, from Sacharomyces Cerevisiae
Class: oxidoreductase
Keywords: Dehydrogenase, NAD+, Oxidoreductase
Deposited on 2012-06-05, released 2012-11-07
The last revision prior to the SCOPe 2.05 freeze date was dated 2013-01-23, with a file datestamp of 2013-01-18.
Experiment type: XRAY
Resolution: 2.45 Å
R-factor: 0.2
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glycerol-3-phosphate dehydrogenase [NAD(+)] 1
    Species: Saccharomyces cerevisiae [TaxId:559292]
    Gene: GPD1, DAR1, HOR1, OSG1, YDL022W, D2830
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4fgwa1, d4fgwa2
  • Chain 'B':
    Compound: Glycerol-3-phosphate dehydrogenase [NAD(+)] 1
    Species: Saccharomyces cerevisiae [TaxId:559292]
    Gene: GPD1, DAR1, HOR1, OSG1, YDL022W, D2830
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4fgwb1, d4fgwb2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4fgwA (A:)
    msaaadrlnltsghlnagrkrssssvslkaaekpfkvtvigsgnwgttiakvvaenckgy
    pevfapivqmwvfeeeingeklteiintrhqnvkylpgitlpdnlvanpdlidsvkdvdi
    ivfniphqflpricsqlkghvdshvraisclkgfevgakgvqllssyiteelgiqcgals
    ganiatevaqehwsettvayhipkdfrgegkdvdhkvlkalfhrpyfhvsviedvagisi
    cgalknvvalgcgfveglgwgnnasaaiqrvglgeiirfgqmffpesreetyyqesagva
    dlittcaggrnvkvarlmatsgkdawecekellngqsaqglitckevhewletcgsvedf
    plfeavyqivynnypmknlpdmieeldlhed
    

    Sequence, based on observed residues (ATOM records): (download)
    >4fgwA (A:)
    kpfkvtvigsgnwgttiakvvaenckgypevfapivqmwvfeeeingeklteiintrhqn
    vkylpgitlpdnlvanpdlidsvkdvdiivfniphqflpricsqlkghvdshvraisclk
    gfevgakgvqllssyiteelgiqcgalsganiatevaqehwsettvayhipkdfrgegkd
    vdhkvlkalfhrpyfhvsviedvagisicgalknvvalgcgfveglgwgnnasaaiqrvg
    lgeiirfgqmffpesreetyyqesagvadlittcaggrnvkvarlmatsgkdawecekel
    lngqsaqglitckevhewletcgsvedfplfeavyqivynnypmknlpdmiee
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4fgwB (B:)
    msaaadrlnltsghlnagrkrssssvslkaaekpfkvtvigsgnwgttiakvvaenckgy
    pevfapivqmwvfeeeingeklteiintrhqnvkylpgitlpdnlvanpdlidsvkdvdi
    ivfniphqflpricsqlkghvdshvraisclkgfevgakgvqllssyiteelgiqcgals
    ganiatevaqehwsettvayhipkdfrgegkdvdhkvlkalfhrpyfhvsviedvagisi
    cgalknvvalgcgfveglgwgnnasaaiqrvglgeiirfgqmffpesreetyyqesagva
    dlittcaggrnvkvarlmatsgkdawecekellngqsaqglitckevhewletcgsvedf
    plfeavyqivynnypmknlpdmieeldlhed
    

    Sequence, based on observed residues (ATOM records): (download)
    >4fgwB (B:)
    kpfkvtvigsgnwgttiakvvaenckgypevfapivqmwvfeeeingeklteiintrhqn
    vkylpgitlpdnlvanpdlidsvkdvdiivfniphqflpricsqlkghvdshvraisclk
    gfevgakgvqllssyiteelgiqcgalsganiatevaqehwsettvayhipkdfrgegkd
    vdhkvlkalfhrpyfhvsviedvagisicgalknvvalgcgfveglgwgnnasaaiqrvg
    lgeiirfgqmffpesreetyyqesagvadlittcaggrnvkvarlmatsgkdawecekel
    lngqsaqglitckevhewletcgsvedfplfeavyqivynnypmknlpdmiee