PDB entry 4fgb

View 4fgb on RCSB PDB site
Description: Crystal structure of human calcium/calmodulin-dependent protein kinase I apo form
Class: transferase
Keywords: CaMK, calmodulin, autoinhibition, regulation mechanism, kinase, transferase
Deposited on 2012-06-04, released 2013-01-23
The last revision prior to the SCOPe 2.04 freeze date was dated 2013-01-23, with a file datestamp of 2013-01-18.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.251
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Calcium/calmodulin-dependent protein kinase type 1
    Species: Homo sapiens [TaxId:9606]
    Gene: CAMK1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d4fgba_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4fgbA (A:)
    mlgavegprwkqaedirdiydfrdvlgtgafsevilaedkrtqklvaikciakealegke
    gsmeneiavlhkikhpnivalddiyesgghlylimqlvsggelfdrivekgfyterdasr
    lifqvldavkylhdlgivhrdlkpenllyysldedskimisdfglskmedpgsvlstacg
    tpgyvapevlaqkpyskavdcwsigviayillcgyppfydendaklfeqilkaeyefdsp
    ywddisdsakdfirhlmekdpekrftceqalqhpwiagdtaldknihqsvseqikknfak
    skwkqafnatavvrhmrklq
    

    Sequence, based on observed residues (ATOM records): (download)
    >4fgbA (A:)
    wkqaedirdiydfrdvlgtgafsevilaedkrtqklvaikciaksmeneiavlhkikhpn
    ivalddiyesgghlylimqlvsggelfdrivekgfyterdasrlifqvldavkylhdlgi
    vhrdlkpenllyysldedskimisdfglskmedpgsvlstacgtpgyvapevlaqkpysk
    avdcwsigviayillcgyppfydendaklfeqilkaeyefdspywddisdsakdfirhlm
    ekdpekrftceqalqhpwiagdtaldknihqsvseqikknfa