PDB entry 4fg8

View 4fg8 on RCSB PDB site
Description: Crystal structure of human calcium/calmodulin-dependent protein kinase I 1-315 in complex with ATP
Class: transferase
Keywords: CaMK, calmodulin, autoinhibition, regulation mechanism, kinase, TRANSFERASE
Deposited on 2012-06-04, released 2013-01-23
The last revision prior to the SCOPe 2.04 freeze date was dated 2013-01-23, with a file datestamp of 2013-01-18.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.198
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Calcium/calmodulin-dependent protein kinase type 1
    Species: Homo sapiens [TaxId:9606]
    Gene: CAMK1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d4fg8a_
  • Chain 'B':
    Compound: Calcium/calmodulin-dependent protein kinase type 1
    Species: Homo sapiens [TaxId:9606]
    Gene: CAMK1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d4fg8b_
  • Heterogens: ATP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4fg8A (A:)
    mlgavegprwkqaedirdiydfrdvlgtgafsevilaedkrtqklvaikciakealegke
    gsmeneiavlhkikhpnivalddiyesgghlylimqlvsggelfdrivekgfyterdasr
    lifqvldavkylhdlgivhrdlkpenllyysldedskimisdfglskmedpgsvlstacg
    tpgyvapevlaqkpyskavdcwsigviayillcgyppfydendaklfeqilkaeyefdsp
    ywddisdsakdfirhlmekdpekrftceqalqhpwiagdtaldknihqsvseqikknfak
    skwkqafnatavvrh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4fg8A (A:)
    wkqaedirdiydfrdvlgtgafsevilaedkrtqklvaikciakeneiavlhkikhpniv
    alddiyesgghlylimqlvsggelfdrivekgfyterdasrlifqvldavkylhdlgivh
    rdlkpenllyysldedskimisdftpgyvapevlaqkpyskavdcwsigviayillcgyp
    pfydendaklfeqilkaeyefdspywddisdsakdfirhlmekdpekrftceqalqhpwi
    agdtaldknihqsvseqikknfa
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4fg8B (B:)
    mlgavegprwkqaedirdiydfrdvlgtgafsevilaedkrtqklvaikciakealegke
    gsmeneiavlhkikhpnivalddiyesgghlylimqlvsggelfdrivekgfyterdasr
    lifqvldavkylhdlgivhrdlkpenllyysldedskimisdfglskmedpgsvlstacg
    tpgyvapevlaqkpyskavdcwsigviayillcgyppfydendaklfeqilkaeyefdsp
    ywddisdsakdfirhlmekdpekrftceqalqhpwiagdtaldknihqsvseqikknfak
    skwkqafnatavvrh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4fg8B (B:)
    edirdiydfrdvlgtgafsevilaedkrtqklvaikciakneiavlhkikhpnivalddi
    yesgghlylimqlvsggelfdrivekgfyterdasrlifqvldavkylhdlgivhrdlkp
    enllyysldedskimisdfggsvlstacgtpgyvapevlaqkpyskavdcwsigviayil
    lcgyppfydendaklfeqilkaeyefdspywddisdsakdfirhlmekdpekrftceqal
    qhpwiagdtaldknihqsvseqikknfa