PDB entry 4ffj

View 4ffj on RCSB PDB site
Description: The crystal structure of spDHBPs from S.pneumoniae
Class: lyase
Keywords: Barrel structure, lyase
Deposited on 2012-06-01, released 2013-07-17
The last revision prior to the SCOPe 2.08 freeze date was dated 2013-07-17, with a file datestamp of 2013-07-12.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.189
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Riboflavin biosynthesis protein ribBA
    Species: Streptococcus pneumoniae [TaxId:1313]
    Gene: ribAB, ribBA, SP_0176
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d4ffja_
  • Heterogens: SO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4ffjA (A:)
    meyrkiqealealqkgrlvlviddkdrenegdlicsaqaattenvnfmatyakglicmpm
    seslanqlmlspmvenntdnhktaftvsidyketttgisaeergltarmcvaeditpsdf
    rrpghmfpliakkggvlernghteatvdllklaglkecglcceimnhdgkmmrtddliqf
    skkhniplitikelqeyrkvydqlvervst
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ffjA (A:)
    meyrkiqealealqkgrlvlviddkdnegdlicsaqaattenvnfmatyakglicmpmse
    slanqlmlspmvetaftvsidyketttgisaeergltarmcvaeditpsdfrrpghmfpl
    iakkggvlernghteatvdllklaglkecglcceimnhdgkmmrtddliqfskkhnipli
    tikelqeyrkvydql