PDB entry 4ffb

View 4ffb on RCSB PDB site
Description: A TOG:alpha/beta-tubulin Complex Structure Reveals Conformation-Based Mechanisms For a Microtubule Polymerase
Class: hydrolase
Keywords: tubulin fold, HEAT repeats, cytoskeleton, microtubule, tubulin, TOG domain, HYDROLASE
Deposited on 2012-05-31, released 2012-08-15
The last revision prior to the SCOPe 2.03 freeze date was dated 2013-08-28, with a file datestamp of 2013-08-23.
Experiment type: XRAY
Resolution: 2.88 Å
R-factor: 0.21
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tubulin alpha-1 chain
    Species: Saccharomyces cerevisiae [TaxId:559292]
    Gene: TUB1, YML085C
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d4ffba1, d4ffba2
  • Chain 'B':
    Compound: Tubulin beta chain
    Species: Saccharomyces cerevisiae [TaxId:559292]
    Gene: TUB2, YFL037W
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02557 (0-End)
      • engineered mutation (178)
    Domains in SCOPe 2.03: d4ffbb1, d4ffbb2
  • Chain 'C':
    Compound: Protein STU2
    Species: Saccharomyces cerevisiae [TaxId:559292]
    Gene: L2108, STU2, YLR045C
    Database cross-references and differences (RAF-indexed):
  • Heterogens: MG, GTP

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4ffbA (A:)
    mrevisinvgqagcqignacwelyslehgikpdghledglskpkggeegfstffhetgyg
    kfvpraiyvdlepnvidevrngpykdlfhpeqlisgkedaannyarghytvgreilgdvl
    drirkladqcdglqgflfthslgggtgsglgsllleelsaeygkksklefavypapqvst
    svvepyntvltthttlehadctfmvdneaiydmckrnldiprpsfanlnnliaqvvssvt
    aslrfdgslnvdlnefqtnlvpyprihfplvsyspvlskskafhesnsvseitnacfepg
    nqmvkcdprdgkymatcllyrgdvvtrdvqraveqvknkktvqlvdwcptgfkigicyep
    ptatpnsqlatvdravcmlsnttsiaeawkridrkfdlmyakrafvhwyvgegmeegeft
    earedlaalerdyievgadsyaeeeef
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ffbA (A:)
    mrevisinvgqagcqignacwelyslehgikpdghledglskpkggeegfstffhetgyg
    kfvpraiyvdlepnvidevrngpykdlfhpeqlisgkedaannyarghytvgreilgdvl
    drirkladqcdglqgflfthslgggtgsglgsllleelsaeygkksklefavypapqvst
    svvepyntvltthttlehadctfmvdneaiydmckrnldiprpsfanlnnliaqvvssvt
    aslrfdgslnvdlnefqtnlvpyprihfplvsyspvlsksesnsvseitnacfepgnqmv
    kcdprdgkymatcllyrgdvvtrdvqraveqvknkktvqlvdwcptgfkigicyepptat
    pnsqlatvdravcmlsnttsiaeawkridrkfdlmyakrafvhwyvgegmeegefteare
    dlaalerdyievgad
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4ffbB (B:)
    mreiihistgqcgnqigaafweticgehgldfngtyhghddiqkerlnvyfneassgkwv
    prsinvdlepgtidavrnsaignlfrpdnyifgqssagnvwakghytegaelvdsvmdvi
    rreaegcdslqgfqithslgggtgsgmgtlliskireefpdrmmatfsvlpspkrsdtrv
    epynatlsvhqlvehsdetfcidnealydicqrtlklnqpsygdlnnlvssvmsgvttsl
    rypgqlnsdlrklavnlvpfprlhffmvgyapltaigsqsfrsltvpeltqqmfdaknmm
    aaadprngryltvaaffrgkvsvkevedemhkvqsknsdyfvewipnnvqtavcsvapqg
    ldmaatfianstsiqelfkrvgdqfsamfkrkaflhwytsegmdelefseaesnmndlvs
    eyqqyqeatveddeevdengdfgapqnqdepitenfehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ffbB (B:)
    mreiihistgqcgnqigaafweticgehgldfngthddiqkerlnvyfneassgkwvprs
    invdlepgtidavrnsaignlfrpdnyifgqssagnvwakghytegaelvdsvmdvirre
    aegcdslqgfqithslgggtgsgmgtlliskireefpdrmmatfsvlpspktrvepynat
    lsvhqlvehsdetfcidnealydicqrtlklnqpsygdlnnlvssvmsgvttslrypgql
    nsdlrklavnlvpfprlhffmvgyapltaigsltvpeltqqmfdaknmmaaadprngryl
    tvaaffrgkvsvkevedemhkvqsknsdyfvewipnnvqtavcsvapqgldmaatfians
    tsiqelfkrvgdqfsamfkrkaflhwytsegmdelefseaesnmndlvseyqqyqeatve
    d
    

  • Chain 'C':
    No sequence available.