PDB entry 4feq

View 4feq on RCSB PDB site
Description: Inhibitor bound structure of the kinase domain of the murine receptor tyrosine kinase TYRO3 (Sky)
Class: transferase/transferase inhibitor
Keywords: Protein kinase domain, Receptor Tyrosine Kinase, Gas6, TRANSFERASE-TRANSFERASE INHIBITOR complex
Deposited on 2012-05-30, released 2013-03-13
The last revision prior to the SCOPe 2.06 freeze date was dated 2013-03-13, with a file datestamp of 2013-03-08.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.278
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tyrosine-protein kinase receptor TYRO3
    Species: Mus musculus [TaxId:10090]
    Gene: Tyro3, Dtk, Rse
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4feqa_
  • Heterogens: 0T8, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4feqA (A:)
    mldslgisdelkekledvlipeqqftlgrmlgkgefgsvreaqlkqedgsfvkvavkmlk
    adiiassdieeflreaacmkefdhphvaklvgvslrsrakgrlpipmvilpfmkhgdlha
    fllasrigenpfnlplqtlvrfmvdiacgmeylssrnfihrdlaarncmlaedmtvcvad
    fglsrkiysgdyyrqgcasklpvkwlalesladnlytvhsdvwafgvtmweimtrgqtpy
    agienaeiynyliggnrlkqppecmeevydlmyqcwsadpkqrpsftclrmelenilghl
    svlstsqdplyinierahhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4feqA (A:)
    eqqftlgrmlgkgsvreaqlkdgsfvkvavkmlflreaacmkefdhphvaklvgvspmvi
    lpfmkhgdlhafllasriplqtlvrfmvdiacgmeylssrnfihrdlaarncmlaedmtv
    cvadfgvkwlalesladnlytvhsdvwafgvtmweimtrgqtpyagienaeiynyliggn
    rlkqppecmeevydlmyqcwsadpkqrpsftclrmelenilghl