PDB entry 4fef

View 4fef on RCSB PDB site
Description: The crystal structures of several mutants of pleurotus eryngii versatile peroxidase
Class: oxidoreductase
Keywords: lignin peroxidase, lignin degradation, aromatic-substrate binding, oxidoreductase
Deposited on 2012-05-30, released 2012-10-24
The last revision prior to the SCOPe 2.08 freeze date was dated 2012-12-19, with a file datestamp of 2012-12-14.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.139
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: versatile peroxidase vpl2
    Species: Pleurotus eryngii [TaxId:5323]
    Gene: vpl2
    Database cross-references and differences (RAF-indexed):
    • Uniprot O94753 (0-314)
      • engineered mutation (140)
      • engineered mutation (190)
    Domains in SCOPe 2.08: d4fefa_
  • Heterogens: CA, HEM, SO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4fefA (A:)
    atcddgrttanaaccilfpilddiqenlfdgaqcgeevheslrltfhdaigfsptlgggg
    adgsiiafdtietnfpanagideivsaqkpfvakhnisagdfiqfagavgvsncpggvri
    pfflgrpdavaaspdhlvpegfdsvdsilarmgdagfspvevvwllashsiaaadkvdps
    ipgtpfdstpevfdsqffietqlkgrlfpgtadnkgeaqsplqgeirlqsdhllardpqt
    acewqsmvnnqpkiqnrfaatmskmallgqdktklidcsdviptppalvgaahlpagfsl
    sdveqacaatpfpal