SCOPe 2.08: Structural Classification of Proteins

PDB entry 4fdh

View 4fdh on RCSB PDB site
Description: Structure of human aldosterone synthase, CYP11B2, in complex with fadrozole
Class: oxidoreductase/oxidoreductase inhibitor
Keywords: cytochrome P450, CYP11B2, Aldosterone synthase, monooxygenase, heme protein, mineralocorticoid, inhibitor, mitochondria, membrane, OXIDOREDUCTASE-OXIDOREDUCTASE INHIBITOR complex
Deposited on 2012-05-28, released 2013-01-30
The last revision prior to the SCOPe 2.08 freeze date was dated 2013-02-13, with a file datestamp of 2013-02-08.
Experiment type: XRAY
Resolution: 2.71 Å
R-factor: 0.228
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

Chain 'A':
Compound: Cytochrome P450 11B2, mitochondrial
Species: Homo sapiens [TaxId:9606]
Gene: Aldosterone synthase, CYP11B2
Database cross-references and differences (RAF-indexed):
- Uniprot P19099 (7-End)
Domains in SCOPe 2.08: d4fdha_
Chain 'B':
Compound: Cytochrome P450 11B2, mitochondrial
Species: Homo sapiens [TaxId:9606]
Gene: Aldosterone synthase, CYP11B2
Database cross-references and differences (RAF-indexed):
- Uniprot P19099 (7-End)
Domains in SCOPe 2.08: d4fdhb_
Chain 'C':
Compound: Cytochrome P450 11B2, mitochondrial
Species: Homo sapiens [TaxId:9606]
Gene: Aldosterone synthase, CYP11B2
Database cross-references and differences (RAF-indexed):
- Uniprot P19099 (7-End)
Domains in SCOPe 2.08: d4fdhc_
Chain 'D':
Compound: Cytochrome P450 11B2, mitochondrial
Species: Homo sapiens [TaxId:9606]
Gene: Aldosterone synthase, CYP11B2
Database cross-references and differences (RAF-indexed):
- Uniprot P19099 (7-End)
Domains in SCOPe 2.08: d4fdhd_
Chain 'E':
Compound: Cytochrome P450 11B2, mitochondrial
Species: Homo sapiens [TaxId:9606]
Gene: Aldosterone synthase, CYP11B2
Database cross-references and differences (RAF-indexed):
- Uniprot P19099 (7-476)
  - expression tag (477-482)
Domains in SCOPe 2.08: d4fdhe1, d4fdhe2
Chain 'F':
Compound: Cytochrome P450 11B2, mitochondrial
Species: Homo sapiens [TaxId:9606]
Gene: Aldosterone synthase, CYP11B2
Database cross-references and differences (RAF-indexed):
- Uniprot P19099 (7-476)
  - expression tag (477-482)
Domains in SCOPe 2.08: d4fdhf1, d4fdhf2
Chain 'G':
Compound: Cytochrome P450 11B2, mitochondrial
Species: Homo sapiens [TaxId:9606]
Gene: Aldosterone synthase, CYP11B2
Database cross-references and differences (RAF-indexed):
- Uniprot P19099 (7-End)
Domains in SCOPe 2.08: d4fdhg_
Chain 'H':
Compound: Cytochrome P450 11B2, mitochondrial
Species: Homo sapiens [TaxId:9606]
Gene: Aldosterone synthase, CYP11B2
Database cross-references and differences (RAF-indexed):
- Uniprot P19099 (7-End)
Domains in SCOPe 2.08: d4fdhh_
Chain 'I':
Compound: Cytochrome P450 11B2, mitochondrial
Species: Homo sapiens [TaxId:9606]
Gene: Aldosterone synthase, CYP11B2
Database cross-references and differences (RAF-indexed):
- Uniprot P19099 (7-End)
Domains in SCOPe 2.08: d4fdhi_
Chain 'J':
Compound: Cytochrome P450 11B2, mitochondrial
Species: Homo sapiens [TaxId:9606]
Gene: Aldosterone synthase, CYP11B2
Database cross-references and differences (RAF-indexed):
- Uniprot P19099 (7-End)
Domains in SCOPe 2.08: d4fdhj_
Chain 'K':
Compound: Cytochrome P450 11B2, mitochondrial
Species: Homo sapiens [TaxId:9606]
Gene: Aldosterone synthase, CYP11B2
Database cross-references and differences (RAF-indexed):
- Uniprot P19099 (7-End)
Domains in SCOPe 2.08: d4fdhk_
Chain 'L':
Compound: Cytochrome P450 11B2, mitochondrial
Species: Homo sapiens [TaxId:9606]
Gene: Aldosterone synthase, CYP11B2
Database cross-references and differences (RAF-indexed):
- Uniprot P19099
Domains in SCOPe 2.08: d4fdhl_
Heterogens: HEM, 0T3, HOH

PDB Chain Sequences:

Chain 'A':
Sequence, based on SEQRES records: (download)

>4fdhA (A:)
makktsstvlpfeampqhpgnrwlrllqiwreqgyehlhlemhqtfqelgpifrynlggp
rmvcvmlpedveklqqvdslhpcrmilepwvayrqhrghkcgvfllngpewrfnrlrlnp
dvlspkavqrflpmvdavardfsqalkkkvlqnargsltldvqpsifhytieasnlalfg
erlglvghspssaslnflhalevmfkstvqlmfmprslsrwispkvwkehfeawdcifqy
gdnciqkiyqelafnrpqhytgivaelllkaelsleaikansmeltagsvdttafpllmt
lfelarnpdvqqilrqeslaaaasisehpqkattelpllraalketlrlypvglflervv
ssdlvlqnyhipagtlvqvflyslgrnaalfprperynpqrwldirgsgrnfhhvpfgfg
mrqclgrrlaeaemllllhhvlkhflvetltqedikmvysfilrpgtsplltfrainhhh
hhh