PDB entry 4fd9

View 4fd9 on RCSB PDB site
Description: Crystal structure of the third beta-gamma-crystallin domain of Crybg3 (betagamma-crystallin domain-containing protein 3) from Mus musculus
Class: structural protein
Keywords: Non-lens vertebrate beta-gamma-crystallin, Brain, STRUCTURAL PROTEIN
Deposited on 2012-05-26, released 2013-04-10
The last revision prior to the SCOPe 2.06 freeze date was dated 2013-04-10, with a file datestamp of 2013-04-05.
Experiment type: XRAY
Resolution: 1.86 Å
R-factor: 0.139
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Beta/gamma crystallin domain-containing protein 3
    Species: MUS MUSCULUS [TaxId:10090]
    Gene: Crybg3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4fd9a_
  • Chain 'B':
    Compound: Beta/gamma crystallin domain-containing protein 3
    Species: MUS MUSCULUS [TaxId:10090]
    Gene: Crybg3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4fd9b_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4fd9A (A:)
    mnlkvilyekphflghtkefsehidsvptflksdkdfhgigsirviggvwvayekehfkg
    qqflleegdfedssacgalsgpimsfrylqan
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4fd9B (B:)
    mnlkvilyekphflghtkefsehidsvptflksdkdfhgigsirviggvwvayekehfkg
    qqflleegdfedssacgalsgpimsfrylqan