PDB entry 4fd8

View 4fd8 on RCSB PDB site
Description: Structure of apo S70C SHV beta-lactamase
Class: hydrolase
Keywords: class A beta-lactamase, hydrolase-hydrolase inhibitor complex, hydrolase
Deposited on 2012-05-26, released 2012-09-26
The last revision prior to the SCOPe 2.06 freeze date was dated 2013-08-07, with a file datestamp of 2013-08-02.
Experiment type: XRAY
Resolution: 1.52 Å
R-factor: 0.168
AEROSPACI score: 0.64 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Beta-lactamase SHV-1
    Species: Klebsiella pneumoniae [TaxId:573]
    Gene: bla, shv1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0AD64 (0-264)
      • engineered mutation (44)
    Domains in SCOPe 2.06: d4fd8a_
  • Heterogens: MA4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4fd8A (A:)
    spqpleqiklsesqlsgrvgmiemdlasgrtltawraderfpmmctfkvvlcgavlarvd
    agdeqlerkihyrqqdlvdyspvsekhladgmtvgelcaaaitmsdnsaanlllatvggp
    agltaflrqigdnvtrldrwetelnealpgdardtttpasmaatlrklltsqrlsarsqr
    qllqwmvddrvagplirsvlpagwfiadktgagergargivallgpnnkaerivviylrd
    tpasmaernqqiagigaaliehwqr