PDB entry 4fco

View 4fco on RCSB PDB site
Description: Crystal structure of bace1 with its inhibitor
Class: Hydrolase/Hydrolase Inhibitor
Keywords: HYDROLASE, Hydrolase-Hydrolase Inhibitor complex
Deposited on 2012-05-25, released 2013-05-29
The last revision prior to the SCOPe 2.04 freeze date was dated 2013-05-29, with a file datestamp of 2013-05-24.
Experiment type: XRAY
Resolution: 1.76 Å
R-factor: 0.164
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Beta-secretase 1
    Species: Homo sapiens [TaxId:9606]
    Gene: BACE, BACE1, KIAA1149
    Database cross-references and differences (RAF-indexed):
    • Uniprot P56817
      • engineered mutation (114)
      • engineered mutation (116)
    Domains in SCOPe 2.04: d4fcoa_
  • Heterogens: SO4, 0U4, URE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4fcoA (A:)
    mgsshhhhhhsagenlyfqgtlpretdeepeepgrrgsfvemvdnlrgksgqgyyvemtv
    gsppqtlnilvdtgssnfavgaaphpflhryyqrqlsstyrdlrkgvyvpytqgawagel
    gtdlvsiphgpnvtvraniaaitesdkffingsnwegilglayaeiarpddslepffdsl
    vkqthvpnlfslqlcgagfplnqsevlasvggsmiiggidhslytgslwytpirrewyye
    viivrveingqdlkmdckeynydksivdsgttnlrlpkkvfeaavksikaasstekfpdg
    fwlgeqlvcwqagttpwnifpvislylmgevtnqsfritilpqqylrpvedvatsqddcy
    kfaisqsstgtvmgavimegfyvvfdrarkrigfavsachvhdefrtaavegpfvtldme
    dcgynipqtdest
    

    Sequence, based on observed residues (ATOM records): (download)
    >4fcoA (A:)
    gsfvemvdnlrgksgqgyyvemtvgsppqtlnilvdtgssnfavgaaphpflhryyqrql
    sstyrdlrkgvyvpytqgawagelgtdlvsiphgpnvtvraniaaitesdkffingsnwe
    gilglayaeiarpddslepffdslvkqthvpnlfslqlcgavggsmiiggidhslytgsl
    wytpirrewyyeviivrveingqdlkmdckeynydksivdsgttnlrlpkkvfeaavksi
    kaasstekfpdgfwlgeqlvcwqagttpwnifpvislylmgevtnqsfritilpqqylrp
    vetsqddcykfaisqsstgtvmgavimegfyvvfdrarkrigfavsachvhdefrtaave
    gpfvtldmedcgyn