PDB entry 4fce

View 4fce on RCSB PDB site
Description: Crystal structure of Yersinia pestis GlmU in complex with alpha-D-glucosamine 1-phosphate (GP1)
Class: transferase
Keywords: glmU. CSGID, NIAID, Structural Genomics, National Institute of Allergy and Infectious Diseases, Center for Structural Genomics of Infectious Diseases, glmU, GP1, alpha-D-glucosamine 1-phosphate, TRANSFERASE
Deposited on 2012-05-24, released 2012-07-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-15, with a file datestamp of 2017-11-10.
Experiment type: XRAY
Resolution: 1.96 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Bifunctional protein glmU
    Species: Yersinia pestis CO92 [TaxId:214092]
    Gene: glmU, YPTB3965
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4fcea1, d4fcea2
  • Heterogens: MG, GP1, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4fceA (A:)
    snamsnssmsvvilaagkgtrmysdlpkvlhplagkpmvqhvidaamklgaqhvhlvygh
    ggellkktladpslnwvlqaeqlgtghamqqaaphfaddedilmlygdvplisvdtlqrl
    laakpeggiglltvkldnpsgygrivrengdvvgivehkdasdaqreineintgilvang
    rdlkrwlslldnnnaqgefyitdiialahadgkkiatvhptrlsevegvnnrlqlsaler
    vfqteqaeklllagvmlldpsrfdlrgelthgrditidtnviieghvilgdrvrigtgcv
    lkncvigddseispytvledarldanctvgpfarlrpgaelaegahvgnfveikkarlgk
    gskaghlsylgdaeigagvnigagtitcnydgankfktiigddvfvgsdtqlvapvtvan
    gatigagttvtrdvaenelvisrvkqvhiqgwkrpvkkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4fceA (A:)
    ssmsvvilaagkgtrmysdlpkvlhplagkpmvqhvidaamklgaqhvhlvyghggellk
    ktlnwvlqaeqlgtghamqqaaphfaddedilmlygdvplisvdtlqrllaakpeggigl
    ltvkldnpsgygrivrengdvvgivehkdasdaqreineintgilvangrdlkrwlslld
    nnnaqgefyitdiialahadgkkiatvhptrlsevegvnnrlqlsalervfqteqaekll
    lagvmlldpsrfdlrgelthgrditidtnviieghvilgdrvrigtgcvlkncvigddse
    ispytvledarldanctvgpfarlrpgaelaegahvgnfveikkarlgkgskaghlsylg
    daeigagvnigagtitcnydgankfktiigddvfvgsdtqlvapvtvangatigagttvt
    rdvaenelvisrvkqvhiqgw