PDB entry 4fcc

View 4fcc on RCSB PDB site
Description: Glutamate dehydrogenase from E. coli
Class: oxidoreductase
Keywords: protein complex, ROSSMANN FOLD, METABOLIC ROLE, NAD, NADP, OXIDOREDUCTASE
Deposited on 2012-05-24, released 2012-09-26
The last revision prior to the SCOPe 2.05 freeze date was dated 2013-01-09, with a file datestamp of 2013-01-04.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.182
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glutamate dehydrogenase
    Species: Escherichia coli O157:H7 [TaxId:83334]
    Gene: gdhA, ECs2467, Z2793
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4fcca1, d4fcca2
  • Chain 'B':
    Compound: glutamate dehydrogenase
    Species: Escherichia coli O157:H7 [TaxId:83334]
    Gene: gdhA, ECs2467, Z2793
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4fccb1, d4fccb2
  • Chain 'C':
    Compound: glutamate dehydrogenase
    Species: Escherichia coli O157:H7 [TaxId:83334]
    Gene: gdhA, ECs2467, Z2793
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4fccc1, d4fccc2
  • Chain 'D':
    Compound: glutamate dehydrogenase
    Species: Escherichia coli O157:H7 [TaxId:83334]
    Gene: gdhA, ECs2467, Z2793
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4fccd1, d4fccd2
  • Chain 'E':
    Compound: glutamate dehydrogenase
    Species: Escherichia coli O157:H7 [TaxId:83334]
    Gene: gdhA, ECs2467, Z2793
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4fcce1, d4fcce2
  • Chain 'F':
    Compound: glutamate dehydrogenase
    Species: Escherichia coli O157:H7 [TaxId:83334]
    Gene: gdhA, ECs2467, Z2793
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4fccf1, d4fccf2
  • Chain 'G':
    Compound: glutamate dehydrogenase
    Species: Escherichia coli O157:H7 [TaxId:83334]
    Gene: gdhA, ECs2467, Z2793
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4fccg1, d4fccg2
  • Chain 'H':
    Compound: glutamate dehydrogenase
    Species: Escherichia coli O157:H7 [TaxId:83334]
    Gene: gdhA, ECs2467, Z2793
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4fcch1, d4fcch2
  • Chain 'I':
    Compound: glutamate dehydrogenase
    Species: Escherichia coli O157:H7 [TaxId:83334]
    Gene: gdhA, ECs2467, Z2793
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4fcci1, d4fcci2
  • Chain 'J':
    Compound: glutamate dehydrogenase
    Species: Escherichia coli O157:H7 [TaxId:83334]
    Gene: gdhA, ECs2467, Z2793
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4fccj1, d4fccj2
  • Chain 'K':
    Compound: glutamate dehydrogenase
    Species: Escherichia coli O157:H7 [TaxId:83334]
    Gene: gdhA, ECs2467, Z2793
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4fcck1, d4fcck2
  • Chain 'L':
    Compound: glutamate dehydrogenase
    Species: Escherichia coli O157:H7 [TaxId:83334]
    Gene: gdhA, ECs2467, Z2793
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4fccl1, d4fccl2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4fccA (A:)
    pgsmdqtyslesflnhvqkrdpnqtefaqavrevmttlwpfleqnpkyrqmsllerlvep
    erviqfrvvwvddrnqvqvnrawrvqfssaigpykggmrfhpsvnlsilkflgfeqtfkn
    alttlpmgggkggsdfdpkgksegevmrfcqalmtelyrhlgadtdvpagdigvggrevg
    fmagmmkklsnntacvftgkglsfggslirpeatgyglvyfteamlkrhgmgfegmrvsv
    sgsgnvaqyaiekamefgarvitasdssgtvvdesgftkeklarlieikssrdgrvadya
    kefglvylegqqpwsvpvdialpcatqneldvdaahqliangvkavaeganmpttieate
    lfqqagvlfapgkaanaggvatsglemaqnaarlgwkaekvdarlhhimldihhacvehg
    gegeqtnyvqganiagfvkvadamlaqgvi
    

    Sequence, based on observed residues (ATOM records): (download)
    >4fccA (A:)
    slesflnhvqkrdpnqtefaqavrevmttlwpfleqnpkyrqmsllerlveperviqfrv
    vwvddrnqvqvnrawrvqfssaigpykggmrfhpsvnlsilkflgfeqtfknalttlpmg
    ggkggsdfdpkgksegevmrfcqalmtelyrhlgadtdvpagdigvggrevgfmagmmkk
    lsnntacvftgkglsfggslirpeatgyglvyfteamlkrhgmgfegmrvsvsgsgnvaq
    yaiekamefgarvitasdssgtvvdesgftkeklarlieikssrdgrvadyakefglvyl
    egqqpwsvpvdialpcatqneldvdaahqliangvkavaeganmpttieatelfqqagvl
    fapgkaanaggvatsglemaqnaarlgwkaekvdarlhhimldihhacvehggegeqtny
    vqganiagfvkvadamlaqgvi
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4fccB (B:)
    pgsmdqtyslesflnhvqkrdpnqtefaqavrevmttlwpfleqnpkyrqmsllerlvep
    erviqfrvvwvddrnqvqvnrawrvqfssaigpykggmrfhpsvnlsilkflgfeqtfkn
    alttlpmgggkggsdfdpkgksegevmrfcqalmtelyrhlgadtdvpagdigvggrevg
    fmagmmkklsnntacvftgkglsfggslirpeatgyglvyfteamlkrhgmgfegmrvsv
    sgsgnvaqyaiekamefgarvitasdssgtvvdesgftkeklarlieikssrdgrvadya
    kefglvylegqqpwsvpvdialpcatqneldvdaahqliangvkavaeganmpttieate
    lfqqagvlfapgkaanaggvatsglemaqnaarlgwkaekvdarlhhimldihhacvehg
    gegeqtnyvqganiagfvkvadamlaqgvi
    

    Sequence, based on observed residues (ATOM records): (download)
    >4fccB (B:)
    slesflnhvqkrdpnqtefaqavrevmttlwpfleqnpkyrqmsllerlveperviqfrv
    vwvddrnqvqvnrawrvqfssaigpykggmrfhpsvnlsilkflgfeqtfknalttlpmg
    ggkggsdfdpkgksegevmrfcqalmtelyrhlgadtdvpagdigvggrevgfmagmmkk
    lsnntacvftgkglsfggslirpeatgyglvyfteamlkrhgmgfegmrvsvsgsgnvaq
    yaiekamefgarvitasdssgtvvdesgftkeklarlieikssrdgrvadyakefglvyl
    egqqpwsvpvdialpcatqneldvdaahqliangvkavaeganmpttieatelfqqagvl
    fapgkaanaggvatsglemaqnaarlgwkaekvdarlhhimldihhacvehggegeqtny
    vqganiagfvkvadamlaqgvi
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4fccC (C:)
    pgsmdqtyslesflnhvqkrdpnqtefaqavrevmttlwpfleqnpkyrqmsllerlvep
    erviqfrvvwvddrnqvqvnrawrvqfssaigpykggmrfhpsvnlsilkflgfeqtfkn
    alttlpmgggkggsdfdpkgksegevmrfcqalmtelyrhlgadtdvpagdigvggrevg
    fmagmmkklsnntacvftgkglsfggslirpeatgyglvyfteamlkrhgmgfegmrvsv
    sgsgnvaqyaiekamefgarvitasdssgtvvdesgftkeklarlieikssrdgrvadya
    kefglvylegqqpwsvpvdialpcatqneldvdaahqliangvkavaeganmpttieate
    lfqqagvlfapgkaanaggvatsglemaqnaarlgwkaekvdarlhhimldihhacvehg
    gegeqtnyvqganiagfvkvadamlaqgvi
    

    Sequence, based on observed residues (ATOM records): (download)
    >4fccC (C:)
    slesflnhvqkrdpnqtefaqavrevmttlwpfleqnpkyrqmsllerlveperviqfrv
    vwvddrnqvqvnrawrvqfssaigpykggmrfhpsvnlsilkflgfeqtfknalttlpmg
    ggkggsdfdpkgksegevmrfcqalmtelyrhlgadtdvpagdigvggrevgfmagmmkk
    lsnntacvftgkglsfggslirpeatgyglvyfteamlkrhgmgfegmrvsvsgsgnvaq
    yaiekamefgarvitasdssgtvvdesgftkeklarlieivadyakefglvylegqqpws
    vpvdialpcatqneldvdaahqliangvkavaeganmpttieatelfqqagvlfapgkaa
    naggvatsglemaqnaarlgwkaekvdarlhhimldihhacvehggegeqtnyvqgania
    gfvkvadamlaqgvi
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4fccD (D:)
    pgsmdqtyslesflnhvqkrdpnqtefaqavrevmttlwpfleqnpkyrqmsllerlvep
    erviqfrvvwvddrnqvqvnrawrvqfssaigpykggmrfhpsvnlsilkflgfeqtfkn
    alttlpmgggkggsdfdpkgksegevmrfcqalmtelyrhlgadtdvpagdigvggrevg
    fmagmmkklsnntacvftgkglsfggslirpeatgyglvyfteamlkrhgmgfegmrvsv
    sgsgnvaqyaiekamefgarvitasdssgtvvdesgftkeklarlieikssrdgrvadya
    kefglvylegqqpwsvpvdialpcatqneldvdaahqliangvkavaeganmpttieate
    lfqqagvlfapgkaanaggvatsglemaqnaarlgwkaekvdarlhhimldihhacvehg
    gegeqtnyvqganiagfvkvadamlaqgvi
    

    Sequence, based on observed residues (ATOM records): (download)
    >4fccD (D:)
    slesflnhvqkrdpnqtefaqavrevmttlwpfleqnpkyrqmsllerlveperviqfrv
    vwvddrnqvqvnrawrvqfssaigpykggmrfhpsvnlsilkflgfeqtfknalttlpmg
    ggkggsdfdpkgksegevmrfcqalmtelyrhlgadtdvpagdigvggrevgfmagmmkk
    lsnntacvftgkglsfggslirpeatgyglvyfteamlkrhgmgfegmrvsvsgsgnvaq
    yaiekamefgarvitasdssgtvvdesgftkeklarlieikssrdgrvadyakefglvyl
    egqqpwsvpvdialpcatqneldvdaahqliangvkavaeganmpttieatelfqqagvl
    fapgkaanaggvatsglemaqnaarlgwkaekvdarlhhimldihhacvehggegeqtny
    vqganiagfvkvadamlaqgvi
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4fccE (E:)
    pgsmdqtyslesflnhvqkrdpnqtefaqavrevmttlwpfleqnpkyrqmsllerlvep
    erviqfrvvwvddrnqvqvnrawrvqfssaigpykggmrfhpsvnlsilkflgfeqtfkn
    alttlpmgggkggsdfdpkgksegevmrfcqalmtelyrhlgadtdvpagdigvggrevg
    fmagmmkklsnntacvftgkglsfggslirpeatgyglvyfteamlkrhgmgfegmrvsv
    sgsgnvaqyaiekamefgarvitasdssgtvvdesgftkeklarlieikssrdgrvadya
    kefglvylegqqpwsvpvdialpcatqneldvdaahqliangvkavaeganmpttieate
    lfqqagvlfapgkaanaggvatsglemaqnaarlgwkaekvdarlhhimldihhacvehg
    gegeqtnyvqganiagfvkvadamlaqgvi
    

    Sequence, based on observed residues (ATOM records): (download)
    >4fccE (E:)
    slesflnhvqkrdpnqtefaqavrevmttlwpfleqnpkyrqmsllerlveperviqfrv
    vwvddrnqvqvnrawrvqfssaigpykggmrfhpsvnlsilkflgfeqtfknalttlpmg
    ggkggsdfdpkgksegevmrfcqalmtelyrhlgadtdvpagdigvggrevgfmagmmkk
    lsnntacvftgkglsfggslirpeatgyglvyfteamlkrhgmgfegmrvsvsgsgnvaq
    yaiekamefgarvitasdssgtvvdesgftkeklarlieikssrdgrvadyakefglvyl
    egqqpwsvpvdialpcatqneldvdaahqliangvkavaeganmpttieatelfqqagvl
    fapgkaanaggvatsglemaqnaarlgwkaekvdarlhhimldihhacvehggegeqtny
    vqganiagfvkvadamlaqgvi
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >4fccF (F:)
    pgsmdqtyslesflnhvqkrdpnqtefaqavrevmttlwpfleqnpkyrqmsllerlvep
    erviqfrvvwvddrnqvqvnrawrvqfssaigpykggmrfhpsvnlsilkflgfeqtfkn
    alttlpmgggkggsdfdpkgksegevmrfcqalmtelyrhlgadtdvpagdigvggrevg
    fmagmmkklsnntacvftgkglsfggslirpeatgyglvyfteamlkrhgmgfegmrvsv
    sgsgnvaqyaiekamefgarvitasdssgtvvdesgftkeklarlieikssrdgrvadya
    kefglvylegqqpwsvpvdialpcatqneldvdaahqliangvkavaeganmpttieate
    lfqqagvlfapgkaanaggvatsglemaqnaarlgwkaekvdarlhhimldihhacvehg
    gegeqtnyvqganiagfvkvadamlaqgvi
    

    Sequence, based on observed residues (ATOM records): (download)
    >4fccF (F:)
    slesflnhvqkrdpnqtefaqavrevmttlwpfleqnpkyrqmsllerlveperviqfrv
    vwvddrnqvqvnrawrvqfssaigpykggmrfhpsvnlsilkflgfeqtfknalttlpmg
    ggkggsdfdpkgksegevmrfcqalmtelyrhlgadtdvpagdigvggrevgfmagmmkk
    lsnntacvftgkglsfggslirpeatgyglvyfteamlkrhgmgfegmrvsvsgsgnvaq
    yaiekamefgarvitasdssgtvvdesgftkeklarlieikssrdgrvadyakefglvyl
    egqqpwsvpvdialpcatqneldvdaahqliangvkavaeganmpttieatelfqqagvl
    fapgkaanaggvatsglemaqnaarlgwkaekvdarlhhimldihhacvehggegeqtny
    vqganiagfvkvadamlaqgvi
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >4fccG (G:)
    pgsmdqtyslesflnhvqkrdpnqtefaqavrevmttlwpfleqnpkyrqmsllerlvep
    erviqfrvvwvddrnqvqvnrawrvqfssaigpykggmrfhpsvnlsilkflgfeqtfkn
    alttlpmgggkggsdfdpkgksegevmrfcqalmtelyrhlgadtdvpagdigvggrevg
    fmagmmkklsnntacvftgkglsfggslirpeatgyglvyfteamlkrhgmgfegmrvsv
    sgsgnvaqyaiekamefgarvitasdssgtvvdesgftkeklarlieikssrdgrvadya
    kefglvylegqqpwsvpvdialpcatqneldvdaahqliangvkavaeganmpttieate
    lfqqagvlfapgkaanaggvatsglemaqnaarlgwkaekvdarlhhimldihhacvehg
    gegeqtnyvqganiagfvkvadamlaqgvi
    

    Sequence, based on observed residues (ATOM records): (download)
    >4fccG (G:)
    slesflnhvqkrdpnqtefaqavrevmttlwpfleqnpkyrqmsllerlveperviqfrv
    vwvddrnqvqvnrawrvqfssaigpykggmrfhpsvnlsilkflgfeqtfknalttlpmg
    ggkggsdfdpkgksegevmrfcqalmtelyrhlgadtdvpagdigvggrevgfmagmmkk
    lsnntacvftgkglsfggslirpeatgyglvyfteamlkrhgmgfegmrvsvsgsgnvaq
    yaiekamefgarvitasdssgtvvdesgftkeklarlieikssrdgrvadyakefglvyl
    egqqpwsvpvdialpcatqneldvdaahqliangvkavaeganmpttieatelfqqagvl
    fapgkaanaggvatsglemaqnaarlgwkaekvdarlhhimldihhacvehggegeqtny
    vqganiagfvkvadamlaqgvi
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >4fccH (H:)
    pgsmdqtyslesflnhvqkrdpnqtefaqavrevmttlwpfleqnpkyrqmsllerlvep
    erviqfrvvwvddrnqvqvnrawrvqfssaigpykggmrfhpsvnlsilkflgfeqtfkn
    alttlpmgggkggsdfdpkgksegevmrfcqalmtelyrhlgadtdvpagdigvggrevg
    fmagmmkklsnntacvftgkglsfggslirpeatgyglvyfteamlkrhgmgfegmrvsv
    sgsgnvaqyaiekamefgarvitasdssgtvvdesgftkeklarlieikssrdgrvadya
    kefglvylegqqpwsvpvdialpcatqneldvdaahqliangvkavaeganmpttieate
    lfqqagvlfapgkaanaggvatsglemaqnaarlgwkaekvdarlhhimldihhacvehg
    gegeqtnyvqganiagfvkvadamlaqgvi
    

    Sequence, based on observed residues (ATOM records): (download)
    >4fccH (H:)
    slesflnhvqkrdpnqtefaqavrevmttlwpfleqnpkyrqmsllerlveperviqfrv
    vwvddrnqvqvnrawrvqfssaigpykggmrfhpsvnlsilkflgfeqtfknalttlpmg
    ggkggsdfdpkgksegevmrfcqalmtelyrhlgadtdvpagdigvggrevgfmagmmkk
    lsnntacvftgkglsfggslirpeatgyglvyfteamlkrhgmgfegmrvsvsgsgnvaq
    yaiekamefgarvitasdssgtvvdesgftkeklarlieiksrvadyakefglvylegqq
    pwsvpvdialpcatqneldvdaahqliangvkavaeganmpttieatelfqqagvlfapg
    kaanaggvatsglemaqnaarlgwkaekvdarlhhimldihhacvehggegeqtnyvqga
    niagfvkvadamlaqgvi
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >4fccI (I:)
    pgsmdqtyslesflnhvqkrdpnqtefaqavrevmttlwpfleqnpkyrqmsllerlvep
    erviqfrvvwvddrnqvqvnrawrvqfssaigpykggmrfhpsvnlsilkflgfeqtfkn
    alttlpmgggkggsdfdpkgksegevmrfcqalmtelyrhlgadtdvpagdigvggrevg
    fmagmmkklsnntacvftgkglsfggslirpeatgyglvyfteamlkrhgmgfegmrvsv
    sgsgnvaqyaiekamefgarvitasdssgtvvdesgftkeklarlieikssrdgrvadya
    kefglvylegqqpwsvpvdialpcatqneldvdaahqliangvkavaeganmpttieate
    lfqqagvlfapgkaanaggvatsglemaqnaarlgwkaekvdarlhhimldihhacvehg
    gegeqtnyvqganiagfvkvadamlaqgvi
    

    Sequence, based on observed residues (ATOM records): (download)
    >4fccI (I:)
    slesflnhvqkrdpnqtefaqavrevmttlwpfleqnpkyrqmsllerlveperviqfrv
    vwvddrnqvqvnrawrvqfssaigpykggmrfhpsvnlsilkflgfeqtfknalttlpmg
    ggkggsdfdpkgksegevmrfcqalmtelyrhlgadtdvpagdigvggrevgfmagmmkk
    lsnntacvftgkglsfggslirpeatgyglvyfteamlkrhgmgfegmrvsvsgsgnvaq
    yaiekamefgarvitasdssgtvvdesgftkeklarlieikssrdgrvadyakefglvyl
    egqqpwsvpvdialpcatqneldvdaahqliangvkavaeganmpttieatelfqqagvl
    fapgkaanaggvatsglemaqnaarlgwkaekvdarlhhimldihhacvehggegeqtny
    vqganiagfvkvadamlaqgvi
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >4fccJ (J:)
    pgsmdqtyslesflnhvqkrdpnqtefaqavrevmttlwpfleqnpkyrqmsllerlvep
    erviqfrvvwvddrnqvqvnrawrvqfssaigpykggmrfhpsvnlsilkflgfeqtfkn
    alttlpmgggkggsdfdpkgksegevmrfcqalmtelyrhlgadtdvpagdigvggrevg
    fmagmmkklsnntacvftgkglsfggslirpeatgyglvyfteamlkrhgmgfegmrvsv
    sgsgnvaqyaiekamefgarvitasdssgtvvdesgftkeklarlieikssrdgrvadya
    kefglvylegqqpwsvpvdialpcatqneldvdaahqliangvkavaeganmpttieate
    lfqqagvlfapgkaanaggvatsglemaqnaarlgwkaekvdarlhhimldihhacvehg
    gegeqtnyvqganiagfvkvadamlaqgvi
    

    Sequence, based on observed residues (ATOM records): (download)
    >4fccJ (J:)
    slesflnhvqkrdpnqtefaqavrevmttlwpfleqnpkyrqmsllerlveperviqfrv
    vwvddrnqvqvnrawrvqfssaigpykggmrfhpsvnlsilkflgfeqtfknalttlpmg
    ggkggsdfdpkgksegevmrfcqalmtelyrhlgadtdvpagdigvggrevgfmagmmkk
    lsnntacvftgkglsfggslirpeatgyglvyfteamlkrhgmgfegmrvsvsgsgnvaq
    yaiekamefgarvitasdssgtvvdesgftkeklarlieikssrdgrvadyakefglvyl
    egqqpwsvpvdialpcatqneldvdaahqliangvkavaeganmpttieatelfqqagvl
    fapgkaanaggvatsglemaqnaarlgwkaekvdarlhhimldihhacvehggegeqtny
    vqganiagfvkvadamlaqgvi
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >4fccK (K:)
    pgsmdqtyslesflnhvqkrdpnqtefaqavrevmttlwpfleqnpkyrqmsllerlvep
    erviqfrvvwvddrnqvqvnrawrvqfssaigpykggmrfhpsvnlsilkflgfeqtfkn
    alttlpmgggkggsdfdpkgksegevmrfcqalmtelyrhlgadtdvpagdigvggrevg
    fmagmmkklsnntacvftgkglsfggslirpeatgyglvyfteamlkrhgmgfegmrvsv
    sgsgnvaqyaiekamefgarvitasdssgtvvdesgftkeklarlieikssrdgrvadya
    kefglvylegqqpwsvpvdialpcatqneldvdaahqliangvkavaeganmpttieate
    lfqqagvlfapgkaanaggvatsglemaqnaarlgwkaekvdarlhhimldihhacvehg
    gegeqtnyvqganiagfvkvadamlaqgvi
    

    Sequence, based on observed residues (ATOM records): (download)
    >4fccK (K:)
    slesflnhvqkrdpnqtefaqavrevmttlwpfleqnpkyrqmsllerlveperviqfrv
    vwvddrnqvqvnrawrvqfssaigpykggmrfhpsvnlsilkflgfeqtfknalttlpmg
    ggkggsdfdpkgksegevmrfcqalmtelyrhlgadtdvpagdigvggrevgfmagmmkk
    lsnntacvftgkglsfggslirpeatgyglvyfteamlkrhgmgfegmrvsvsgsgnvaq
    yaiekamefgarvitasdssgtvvdesgftkeklarlieikssrdgrvadyakefglvyl
    egqqpwsvpvdialpcatqneldvdaahqliangvkavaeganmpttieatelfqqagvl
    fapgkaanaggvatsglemaqnaarlgwkaekvdarlhhimldihhacvehggegeqtny
    vqganiagfvkvadamlaqgvi
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >4fccL (L:)
    pgsmdqtyslesflnhvqkrdpnqtefaqavrevmttlwpfleqnpkyrqmsllerlvep
    erviqfrvvwvddrnqvqvnrawrvqfssaigpykggmrfhpsvnlsilkflgfeqtfkn
    alttlpmgggkggsdfdpkgksegevmrfcqalmtelyrhlgadtdvpagdigvggrevg
    fmagmmkklsnntacvftgkglsfggslirpeatgyglvyfteamlkrhgmgfegmrvsv
    sgsgnvaqyaiekamefgarvitasdssgtvvdesgftkeklarlieikssrdgrvadya
    kefglvylegqqpwsvpvdialpcatqneldvdaahqliangvkavaeganmpttieate
    lfqqagvlfapgkaanaggvatsglemaqnaarlgwkaekvdarlhhimldihhacvehg
    gegeqtnyvqganiagfvkvadamlaqgvi
    

    Sequence, based on observed residues (ATOM records): (download)
    >4fccL (L:)
    slesflnhvqkrdpnqtefaqavrevmttlwpfleqnpkyrqmsllerlveperviqfrv
    vwvddrnqvqvnrawrvqfssaigpykggmrfhpsvnlsilkflgfeqtfknalttlpmg
    ggkggsdfdpkgksegevmrfcqalmtelyrhlgadtdvpagdigvggrevgfmagmmkk
    lsnntacvftgkglsfggslirpeatgyglvyfteamlkrhgmgfegmrvsvsgsgnvaq
    yaiekamefgarvitasdssgtvvdesgftkeklarlieikssrdgrvadyakefglvyl
    egqqpwsvpvdialpcatqneldvdaahqliangvkavaeganmpttieatelfqqagvl
    fapgkaanaggvatsglemaqnaarlgwkaekvdarlhhimldihhacvehggegeqtny
    vqganiagfvkvadamlaqgvi