PDB entry 4fc2

View 4fc2 on RCSB PDB site
Description: Crystal structure of mouse poly(ADP-ribose) glycohydrolase (PARG) catalytic domain
Class: hydrolase
Keywords: mouse, PARG, poly(ADP-ribose) glycohydrolase, HYDROLASE
Deposited on 2012-05-23, released 2012-06-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-01-29, with a file datestamp of 2014-01-24.
Experiment type: XRAY
Resolution: 1.91 Å
R-factor: 0.176
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Poly(ADP-ribose) glycohydrolase
    Species: Mus musculus [TaxId:10090]
    Gene: parG
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4fc2a_
  • Chain 'B':
    Compound: Poly(ADP-ribose) glycohydrolase
    Species: Mus musculus [TaxId:10090]
    Gene: parG
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4fc2b_
  • Chain 'C':
    Compound: Poly(ADP-ribose) glycohydrolase
    Species: Mus musculus [TaxId:10090]
    Gene: parG
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4fc2c_
  • Chain 'D':
    Compound: Poly(ADP-ribose) glycohydrolase
    Species: Mus musculus [TaxId:10090]
    Gene: parG
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4fc2d_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4fc2A (A:)
    nlppekkwlgtpieemrkmprcgihlpslrpsashtvtvrvdllragevpkpfpthykdl
    wdnkhvkmpcseqnlypvedengertagsrweliqtallnkftrpqnlkdailkynvays
    kkwdftalvdfwdkvleeaeaqhlyqsilpdmvkialclpnictqpipllkqkmnhsvtm
    sqeqiasllanaffctfprrnakmkseyssypdinfnrlfegrssrkpeklktlfcyfrr
    vtekkptglvtftrqsledfpewercekpltrlhvtyegtiegngrgmlqvdfanrfvgg
    gvtgaglvqeeirflinpelivsrlftevldhnecliitgteqyseytgyaetyrwarsh
    edgsekddwqrrcteivaidalhfrryldqfvpekvrrelnkaycgflrpgvpsenlsav
    atgnwgcgafggdarlkaliqilaaaaaerdvvyftfgdselmrdiysmhtflterkldv
    gkvyklllryyneecrncstpgpdiklypfiyhavessaet
    

    Sequence, based on observed residues (ATOM records): (download)
    >4fc2A (A:)
    pekkwlgtpieemrkmprcgihlpslrpsashtvtvrvdllragevpkpfpthykdlwdn
    khvkmpcseqnlyptagsrweliqtallnkftrpqnlkdailkynvayskkwdftalvdf
    wdkvleeaeaqhlyqsilpdmvkialclpnictqpipllkqkmnhsvtmsqeqiasllan
    affctfprrnakmkseyssypdinfnrlfegrssrkpeklktlfcyfrrvtekkptglvt
    ftrqsledfpewercekpltrlhvtyegtiegngrgmlqvdfanrfvgggvtgaglvqee
    irflinpelivsrlftevldhnecliitgteqyseytgyaetyrwarshedgsekddwqr
    rcteivaidalhfrryldqfvpekvrrelnkaycgflrpgvpsenlsavatgnwgcgafg
    gdarlkaliqilaaaaaerdvvyftfgdselmrdiysmhtflterkldvgkvyklllryy
    neecrncstpgpdiklypfiyhavessa
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4fc2B (B:)
    nlppekkwlgtpieemrkmprcgihlpslrpsashtvtvrvdllragevpkpfpthykdl
    wdnkhvkmpcseqnlypvedengertagsrweliqtallnkftrpqnlkdailkynvays
    kkwdftalvdfwdkvleeaeaqhlyqsilpdmvkialclpnictqpipllkqkmnhsvtm
    sqeqiasllanaffctfprrnakmkseyssypdinfnrlfegrssrkpeklktlfcyfrr
    vtekkptglvtftrqsledfpewercekpltrlhvtyegtiegngrgmlqvdfanrfvgg
    gvtgaglvqeeirflinpelivsrlftevldhnecliitgteqyseytgyaetyrwarsh
    edgsekddwqrrcteivaidalhfrryldqfvpekvrrelnkaycgflrpgvpsenlsav
    atgnwgcgafggdarlkaliqilaaaaaerdvvyftfgdselmrdiysmhtflterkldv
    gkvyklllryyneecrncstpgpdiklypfiyhavessaet
    

    Sequence, based on observed residues (ATOM records): (download)
    >4fc2B (B:)
    pekkwlgtpieemrkmprcgihlpslrpsashtvtvrvdllragevpkpfpthykdlwdn
    khvkmpcseqnlypagsrweliqtallnkftrpqnlkdailkynvayskkwdftalvdfw
    dkvleeaeaqhlyqsilpdmvkialclpnictqpipllkqkmnhsvtmsqeqiasllana
    ffctfprrnakmkseyssypdinfnrlfegrssrkpeklktlfcyfrrvtekkptglvtf
    trqsledfpewercekpltrlhvtyegtiegngrgmlqvdfanrfvgggvtgaglvqeei
    rflinpelivsrlftevldhnecliitgteqyseytgyaetyrwarshedgsekddwqrr
    cteivaidalhfrryldqfvpekvrrelnkaycgflrpgvpsenlsavatgnwgcgafgg
    darlkaliqilaaaaaerdvvyftfgdselmrdiysmhtflterkldvgkvyklllryyn
    eecrncstpgpdiklypfiyhavessa
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4fc2C (C:)
    nlppekkwlgtpieemrkmprcgihlpslrpsashtvtvrvdllragevpkpfpthykdl
    wdnkhvkmpcseqnlypvedengertagsrweliqtallnkftrpqnlkdailkynvays
    kkwdftalvdfwdkvleeaeaqhlyqsilpdmvkialclpnictqpipllkqkmnhsvtm
    sqeqiasllanaffctfprrnakmkseyssypdinfnrlfegrssrkpeklktlfcyfrr
    vtekkptglvtftrqsledfpewercekpltrlhvtyegtiegngrgmlqvdfanrfvgg
    gvtgaglvqeeirflinpelivsrlftevldhnecliitgteqyseytgyaetyrwarsh
    edgsekddwqrrcteivaidalhfrryldqfvpekvrrelnkaycgflrpgvpsenlsav
    atgnwgcgafggdarlkaliqilaaaaaerdvvyftfgdselmrdiysmhtflterkldv
    gkvyklllryyneecrncstpgpdiklypfiyhavessaet
    

    Sequence, based on observed residues (ATOM records): (download)
    >4fc2C (C:)
    pekkwlgtpieemrkmprcgihlpslrpsashtvtvrvdllragevpkpfpthykdlwdn
    khvkmpcseqnlyptagsrweliqtallnkftrpqnlkdailkynvayskkwdftalvdf
    wdkvleeaeaqhlyqsilpdmvkialclpnictqpipllkqkmnhsvtmsqeqiasllan
    affctfprrnakmkseyssypdinfnrlfegrssrkpeklktlfcyfrrvtekkptglvt
    ftrqsledfpewercekpltrlhvtyegtiegngrgmlqvdfanrfvgggvtgaglvqee
    irflinpelivsrlftevldhnecliitgteqyseytgyaetyrwarshedgsekddwqr
    rcteivaidalhfrryldqfvpekvrrelnkaycgflrpgvpsenlsavatgnwgcgafg
    gdarlkaliqilaaaaaerdvvyftfgdselmrdiysmhtflterkldvgkvyklllryy
    neecrncstpgpdiklypfiyhavessa
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4fc2D (D:)
    nlppekkwlgtpieemrkmprcgihlpslrpsashtvtvrvdllragevpkpfpthykdl
    wdnkhvkmpcseqnlypvedengertagsrweliqtallnkftrpqnlkdailkynvays
    kkwdftalvdfwdkvleeaeaqhlyqsilpdmvkialclpnictqpipllkqkmnhsvtm
    sqeqiasllanaffctfprrnakmkseyssypdinfnrlfegrssrkpeklktlfcyfrr
    vtekkptglvtftrqsledfpewercekpltrlhvtyegtiegngrgmlqvdfanrfvgg
    gvtgaglvqeeirflinpelivsrlftevldhnecliitgteqyseytgyaetyrwarsh
    edgsekddwqrrcteivaidalhfrryldqfvpekvrrelnkaycgflrpgvpsenlsav
    atgnwgcgafggdarlkaliqilaaaaaerdvvyftfgdselmrdiysmhtflterkldv
    gkvyklllryyneecrncstpgpdiklypfiyhavessaet
    

    Sequence, based on observed residues (ATOM records): (download)
    >4fc2D (D:)
    ppekkwlgtpieemrkmprcgihlpslrpsashtvtvrvdllragevpkpfpthykdlwd
    nkhvkmpcseqnlypagsrweliqtallnkftrpqnlkdailkynvayskkwdftalvdf
    wdkvleeaeaqhlyqsilpdmvkialclpnictqpipllkqkmnhsvtmsqeqiasllan
    affctfprrnakmkseyssypdinfnrlfegrssrkpeklktlfcyfrrvtekkptglvt
    ftrqsledfpewercekpltrlhvtyegtiegngrgmlqvdfanrfvgggvtgaglvqee
    irflinpelivsrlftevldhnecliitgteqyseytgyaetyrwarshedgsekddwqr
    rcteivaidalhfrryldqfvpekvrrelnkaycgflrpgvpsenlsavatgnwgcgafg
    gdarlkaliqilaaaaaerdvvyftfgdselmrdiysmhtflterkldvgkvyklllryy
    neecrncstpgpdiklypfiyhavessa