PDB entry 4fc0

View 4fc0 on RCSB PDB site
Description: Crystal Structure of Human Kinase Domain of B-raf with a DFG-out Inhibitor
Class: transferase/transferase inhibitor
Keywords: human serine/theronine protein Kinase, kinase drug complex, TRANSFERASE-TRANSFERASE INHIBITOR complex
Deposited on 2012-05-23, released 2014-01-08
The last revision prior to the SCOPe 2.04 freeze date was dated 2014-01-08, with a file datestamp of 2014-01-03.
Experiment type: XRAY
Resolution: 2.95 Å
R-factor: 0.2
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Serine/threonine-protein kinase B-raf
    Species: Homo sapiens [TaxId:9606]
    Gene: BRAF, BRAF1, P94, RAFB1, V-RAF MURINE SARCOMA VIRAL ONCOGENE HOMOLOG B1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d4fc0a_
  • Chain 'B':
    Compound: Serine/threonine-protein kinase B-raf
    Species: Homo sapiens [TaxId:9606]
    Gene: BRAF, BRAF1, P94, RAFB1, V-RAF MURINE SARCOMA VIRAL ONCOGENE HOMOLOG B1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d4fc0b_
  • Heterogens: 0T2, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4fc0A (A:)
    gsdssddweipdgqitvgqrigsgsfgtvykgkwhgdvavkmlnvtaptpqqlqafknev
    gvlrktrhvnillfmgystkpqlaivtqwcegsslyhhlhiietkfemiklidiarqtaq
    gmdylhaksiihrdlksnniflhedltvkigdfglatvksrwsgshqfeqlsgsilwmap
    evirmqdknpysfqsdvyafgivlyelmtgqlpysninnrdqiifmvgrgylspdlskvr
    sncpkamkrlmaeclkkkrderplfpqilasiellarslpkihr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4fc0A (A:)
    ddweipdgqitvgqrigsgsfgtvykgkwhgdvavkmlnvtaptpqqlqafknevgvlrk
    trhvnillfmgystkpqlaivtqwcegsslyhhlhiietkfemiklidiarqtaqgmdyl
    haksiihrdlksnniflhedltvkigdfggsilwmapevirmnpysfqsdvyafgivlye
    lmtgqlpysninnrdqiifmvgrgylspdlskvrsncpkamkrlmaeclkkkrderplfp
    qilasiellarslp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4fc0B (B:)
    gsdssddweipdgqitvgqrigsgsfgtvykgkwhgdvavkmlnvtaptpqqlqafknev
    gvlrktrhvnillfmgystkpqlaivtqwcegsslyhhlhiietkfemiklidiarqtaq
    gmdylhaksiihrdlksnniflhedltvkigdfglatvksrwsgshqfeqlsgsilwmap
    evirmqdknpysfqsdvyafgivlyelmtgqlpysninnrdqiifmvgrgylspdlskvr
    sncpkamkrlmaeclkkkrderplfpqilasiellarslpkihr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4fc0B (B:)
    ddweipdgqitvgqrigsgsfgtvykgkwhgdvavkmlnvtaptpqqlqafknevgvlrk
    trhvnillfmgystkpqlaivtqwcegsslyhhlhiietkfemiklidiarqtaqgmdyl
    haksiihrdlksnniflhedltvkigdfglatvksrwgsilwmapevirmqdknpysfqs
    dvyafgivlyelmtgqlpysninnrdqiifmvgrgylspdlskvrsncpkamkrlmaecl
    kkkrderplfpqilasiellars