PDB entry 4fb1

View 4fb1 on RCSB PDB site
Description: Crystal Structure of WT MauG in Complex with Pre-Methylamine Dehydrogenase Aged 60 Days
Class: Oxidoreductase/Electron Transfer
Keywords: trytpophan tryptophylquinone, Oxidoreductase-Electron Transfe complex, Oxidoreductase-Electron Transfer complex
Deposited on 2012-05-22, released 2013-03-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-04-17, with a file datestamp of 2013-04-12.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: 0.165
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Methylamine utilization protein MauG
  Species: Paracoccus denitrificans [TaxId:318586]
  Gene: mauG, Pden_4736
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q51658
• Chain 'B':
  Compound: Methylamine utilization protein MauG
  Species: Paracoccus denitrificans [TaxId:318586]
  Gene: mauG, Pden_4736
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q51658
• Chain 'C':
  Compound: Methylamine dehydrogenase light chain
  Species: Paracoccus denitrificans [TaxId:266]
  Gene: mauA
  Database cross-references and differences (RAF-indexed):
  • Uniprot P22619 (Start-130)
  Domains in SCOPe 2.07: d4fb1c_
• Chain 'D':
  Compound: Methylamine dehydrogenase heavy chain
  Species: Paracoccus denitrificans [TaxId:318586]
  Gene: Pden_4730
  Database cross-references and differences (RAF-indexed):
  • Uniprot A1BB97 (Start-384)
• Chain 'E':
  Compound: Methylamine dehydrogenase light chain
  Species: Paracoccus denitrificans [TaxId:266]
  Gene: mauA
  Database cross-references and differences (RAF-indexed):
  • Uniprot P22619 (Start-130)
  Domains in SCOPe 2.07: d4fb1e_
• Chain 'F':
  Compound: Methylamine dehydrogenase heavy chain
  Species: Paracoccus denitrificans [TaxId:318586]
  Gene: Pden_4730
  Database cross-references and differences (RAF-indexed):
  • Uniprot A1BB97 (Start-384)
• Heterogens: CA, HEC, NA, MES, HOH

PDB Chain Sequences:

• Chain 'A':
  No sequence available.
  
  
• Chain 'B':
  No sequence available.
  
  
• Chain 'C':
  Sequence, based on SEQRES records: (download)
  

  >4fb1C (C:)
  adapagtdprakwvpqdndiqacdywrhcsidgnicdcsggsltncppgtklataswvas
  cynptdgqsyliayrdccgynvsgrcpclntegelpvyrpefandiiwcfgaeddamtyh
  ctispivgkashhhhhh
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >4fb1C (C:)
  tdprakwvpqdndiqacdywrhcsidgnicdcsggsltncppgtklataswvascynptd
  gqsyliayrdccgynvsgrcpclntegelpvyrpefandiiwcfgaeddamtyhctispi
  vgkas
  

  
  
• Chain 'D':
  No sequence available.
  
  
• Chain 'E':
  Sequence, based on SEQRES records: (download)
  

  >4fb1E (E:)
  adapagtdprakwvpqdndiqacdywrhcsidgnicdcsggsltncppgtklataswvas
  cynptdgqsyliayrdccgynvsgrcpclntegelpvyrpefandiiwcfgaeddamtyh
  ctispivgkashhhhhh
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >4fb1E (E:)
  tdprakwvpqdndiqacdywrhcsidgnicdcsggsltncppgtklataswvascynptd
  gqsyliayrdccgynvsgrcpclntegelpvyrpefandiiwcfgaeddamtyhctispi
  vgkas
  

  
  
• Chain 'F':
  No sequence available.