PDB entry 4faz

View 4faz on RCSB PDB site
Description: Kinetic and structural characterization of the 4-oxalocrotonate tautomerase isozymes from Methylibium petroleiphilum
Class: isomerase
Keywords: alpha/beta fold, Tautomerase, ISOMERASE
Deposited on 2012-05-22, released 2013-06-05
The last revision prior to the SCOPe 2.08 freeze date was dated 2014-03-26, with a file datestamp of 2014-03-21.
Experiment type: XRAY
Resolution: 1.57 Å
R-factor: 0.231
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: 4-oxalocrotonate isomerase protein
  Species: Methylibium petroleiphilum [TaxId:420662]
  Gene: Mpe_A2265
  Database cross-references and differences (RAF-indexed):
  • Uniprot A2SI32 (0-61)
  Domains in SCOPe 2.08: d4faza_
• Chain 'B':
  Compound: 4-oxalocrotonate isomerase protein
  Species: Methylibium petroleiphilum [TaxId:420662]
  Gene: Mpe_A2265
  Database cross-references and differences (RAF-indexed):
  • Uniprot A2SI32 (0-61)
  Domains in SCOPe 2.08: d4fazb_
• Chain 'C':
  Compound: 4-oxalocrotonate isomerase protein
  Species: Methylibium petroleiphilum [TaxId:420662]
  Gene: Mpe_A2265
  Database cross-references and differences (RAF-indexed):
  • Uniprot A2SI32 (0-61)
  Domains in SCOPe 2.08: d4fazc_
• Heterogens: SO4, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >4fazA (A:)
  pfaqiyliegrteeqkraviekvtqammeavgapkenvrvwihdvpkenwgiggvsakal
  gr
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >4fazB (B:)
  pfaqiyliegrteeqkraviekvtqammeavgapkenvrvwihdvpkenwgiggvsakal
  gr
  

  
  
• Chain 'C':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >4fazC (C:)
  pfaqiyliegrteeqkraviekvtqammeavgapkenvrvwihdvpkenwgiggvsakal
  gr