PDB entry 4fap

View 4fap on RCSB PDB site
Description: atomic structures of the rapamycin analogs in complex with both human fkbp12 and frb domain of frap
Deposited on 1999-05-06, released 2000-09-13
The last revision prior to the SCOP 1.71 freeze date was dated 2000-09-13, with a file datestamp of 2000-09-13.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.184
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d4fapa_
  • Chain 'B':
    Domains in SCOP 1.71: d4fapb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4fapA (A:)
gvqvetispgdgrtfpkrgqtcvvhytgmledgkkfdssrdrnkpfkfmlgkqevirgwe
egvaqmsvgqrakltispdyaygatghpgiipphatlvfdvellkle

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4fapB (B:)
vailwhemwhegleeasrlyfgernvkgmfevleplhammergpqtlketsfnqaygrdl
meaqewcrkymksgnvkdltqawdlyyhvfrris