PDB entry 4fak

View 4fak on RCSB PDB site
Description: Crystal Structure of OrfX in Complex with S-Adenosylmethionine
Class: transferase, ribosomal protein
Keywords: alpha/beta methyltransferase Rossmann fold, rRNA methylation, AdoMet, rRNA, TRANSFERASE, RIBOSOMAL PROTEIN
Deposited on 2012-05-22, released 2012-06-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-01-30, with a file datestamp of 2013-01-25.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.207
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ribosomal RNA large subunit methyltransferase H
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: orfx, rlmH
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0C1V0 (4-162)
      • expression tag (0-3)
    Domains in SCOPe 2.07: d4faka1, d4faka2
  • Heterogens: SAM, PG4, PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4fakA (A:)
    aaefmkitilavgklkekywkqaiaeyekrlgpytkidiievpdekapenmsdkeieqvk
    ekegqrilakikpqstvitleiqgkmlsseglaqelnqrmtqgqsdfvfviggsnglhkd
    vlqrsnyalsfskmtfphqmmrvvlieqvyrafkimrgeayhk