PDB entry 4faf

View 4faf on RCSB PDB site
Description: Substrate CA/p2 in Complex with a Human Immunodeficiency Virus Type 1 Protease Variant
Class: viral protein
Keywords: protease, VIRAL PROTEIN
Deposited on 2012-05-22, released 2012-08-29
The last revision prior to the SCOPe 2.04 freeze date was dated 2012-08-29, with a file datestamp of 2012-08-24.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.176
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hiv-1 protease
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q000H7 (0-98)
      • engineered mutation (24)
      • engineered mutation (34-35)
      • engineered mutation (45)
    Domains in SCOPe 2.04: d4fafa_
  • Chain 'B':
    Compound: hiv-1 protease
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q000H7 (0-98)
      • engineered mutation (24)
      • engineered mutation (34-35)
      • engineered mutation (45)
    Domains in SCOPe 2.04: d4fafb_
  • Chain 'D':
    Compound: substrate CA/p2 peptide
    Database cross-references and differences (RAF-indexed):
    • PDB 4FAF (0-6)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4fafA (A:)
    pqitlwqrpivtikiggqlkeallntgaddtvleevnlpgrwkpkliggiggfvkvrqyd
    qvpieicghkvigtvlvgptptnvigrnlmtqigctlnf
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4fafB (B:)
    pqitlwqrpivtikiggqlkeallntgaddtvleevnlpgrwkpkliggiggfvkvrqyd
    qvpieicghkvigtvlvgptptnvigrnlmtqigctlnf
    

  • Chain 'D':
    No sequence available.