PDB entry 4faf
View 4faf on RCSB PDB site
Description: Substrate CA/p2 in Complex with a Human Immunodeficiency Virus Type 1 Protease Variant
Class: viral protein
Keywords: protease, VIRAL PROTEIN
Deposited on
2012-05-22, released
2012-08-29
The last revision prior to the SCOPe 2.04 freeze date was dated
2012-08-29, with a file datestamp of
2012-08-24.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.176
AEROSPACI score: 0.43
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: hiv-1 protease
Species: Human immunodeficiency virus 1 [TaxId:11676]
Database cross-references and differences (RAF-indexed):
- Uniprot Q000H7 (0-98)
- engineered mutation (24)
- engineered mutation (34-35)
- engineered mutation (45)
Domains in SCOPe 2.04: d4fafa_ - Chain 'B':
Compound: hiv-1 protease
Species: Human immunodeficiency virus 1 [TaxId:11676]
Database cross-references and differences (RAF-indexed):
- Uniprot Q000H7 (0-98)
- engineered mutation (24)
- engineered mutation (34-35)
- engineered mutation (45)
Domains in SCOPe 2.04: d4fafb_ - Chain 'D':
Compound: substrate CA/p2 peptide
Database cross-references and differences (RAF-indexed):
- Heterogens: HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>4fafA (A:)
pqitlwqrpivtikiggqlkeallntgaddtvleevnlpgrwkpkliggiggfvkvrqyd
qvpieicghkvigtvlvgptptnvigrnlmtqigctlnf
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>4fafB (B:)
pqitlwqrpivtikiggqlkeallntgaddtvleevnlpgrwkpkliggiggfvkvrqyd
qvpieicghkvigtvlvgptptnvigrnlmtqigctlnf
- Chain 'D':
No sequence available.