PDB entry 4fab

View 4fab on RCSB PDB site
Description: three-dimensional structure of a fluorescein-fab complex crystallized in 2-methyl-2,4-pentanediol
Class: immunoglobulin
Keywords: immunoglobulin
Deposited on 1989-04-10, released 1990-07-15
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-08-25, with a file datestamp of 2009-08-21.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.215
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: igg2a-kappa 4-4-20 fab (heavy chain)
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4fabh1, d4fabh2
  • Chain 'L':
    Compound: igg2a-kappa 4-4-20 fab (light chain)
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • GB AAB09710 (0-218)
      • conflict (1)
      • conflict (6)
      • conflict (28)
      • conflict (32)
      • conflict (38)
      • conflict (40)
      • conflict (50)
      • conflict (91)
      • conflict (93)
      • conflict (95-96)
      • conflict (216)
    Domains in SCOPe 2.05: d4fabl1, d4fabl2
  • Heterogens: FDS, MPD

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4fabH (H:)
    evkldetggglvqpgrpmklscvasgftfsdywmnwvrqspekglewvaqirnkpynyet
    yysdsvkgrftisrddskssvylqmnnlrvedmgiyyctgsyygmdywgqgtsvtvssak
    ttapsvyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsdly
    tlsssvtvtsstwpsqsitcnvahpasstkvdkkie
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4fabL (L:)
    dvvmtqtplslpvslgdqasiscrssqslvhsqgntylrwylqkpgqspkvliykvsnrf
    sgvpdrfsgsgsgtdftlkisrveaedlgvyfcsqsthvpwtfgggtkleikradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnrnec