PDB entry 4f9y

View 4f9y on RCSB PDB site
Description: Human P38 alpha MAPK In Complex With a Novel and Selective Small Molecule Inhibitor
Class: transferase/transferase inhibitor
Keywords: protein kinase catalytic domain, TRANSFERASE-TRANSFERASE INHIBITOR complex
Deposited on 2012-05-21, released 2013-06-05
The last revision prior to the SCOPe 2.06 freeze date was dated 2013-07-24, with a file datestamp of 2013-07-19.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.169
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Mitogen-activated protein kinase 14
    Species: Homo sapiens [TaxId:9606]
    Gene: MAPK14, CSBP, CSBP1, CSBP2, CSPB1, MXI2, SAPK2A
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4f9ya_
  • Heterogens: GG5, LM3, BME, PEG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4f9yA (A:)
    mhhhhhhssgvdlgtenlyfqsnasqerptfyrqelnktiwevperyqnlspvgsgaygs
    vcaafdtktglrvavkklsrpfqsiihakrtyrelrllkhmkhenviglldvftparsle
    efndvylvthlmgadlnnivkcqkltddhvqfliyqilrglkyihsadiihrdlkpsnla
    vnedcelkildfglarhtddemtgyvatrwyrapeimlnwmhynqtvdiwsvgcimaell
    tgrtlfpgtdhidqlklilrlvgtpgaellkkissesarnyiqsltqmpkmnfanvfiga
    nplavdllekmlvldsdkritaaqalahayfaqyhdpddepvadpydqsfesrdllidew
    ksltydevisfvpppldqeemes
    

    Sequence, based on observed residues (ATOM records): (download)
    >4f9yA (A:)
    rptfyrqelnktiwevperyqnlspvgsgaygsvcaafdtktglrvavkklsrpfqsiih
    akrtyrelrllkhmkhenviglldvftparsleefndvylvthlmgadlnnivkcqkltd
    dhvqfliyqilrglkyihsadiihrdlkpsnlavnedcelkildfglavatrwyrapeim
    lnwmhynqtvdiwsvgcimaelltgrtlfpgtdhidqlklilrlvgtpgaellkkisses
    arnyiqsltqmpkmnfanvfiganplavdllekmlvldsdkritaaqalahayfaqyhdp
    ddepvadpydqsfesrdllidewksltydevisfvpppl