PDB entry 4f9o

View 4f9o on RCSB PDB site
Description: Crystal Structure of recombinant human Hexokinase type I with 2-deoxy-Glucose 6-Phosphate
Class: transferase
Keywords: hexokinase, 2-deoxy Glucose-6-Phosphate, TRANSFERASE
Deposited on 2012-05-19, released 2013-06-12
The last revision prior to the SCOPe 2.06 freeze date was dated 2013-06-12, with a file datestamp of 2013-06-07.
Experiment type: XRAY
Resolution: 2.65 Å
R-factor: 0.241
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hexokinase-1
    Species: Homo sapiens [TaxId:9606]
    Gene: HK1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4f9oa1, d4f9oa2, d4f9oa3, d4f9oa4
  • Chain 'B':
    Compound: Hexokinase-1
    Species: Homo sapiens [TaxId:9606]
    Gene: HK1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4f9ob1, d4f9ob2, d4f9ob3, d4f9ob4
  • Heterogens: BGC, 0NZ, NA, CIT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4f9oA (A:)
    miaaqllayyftelkddqvkkidkylyamrlsdetlidimtrfrkemknglsrdfnptat
    vkmlptfvrsipdgsekgdfialdlggssfrilrvqvnheknqnvhmesevydtpenivh
    gsgsqlfdhvaeclgdfmekrkikdkklpvgftfsfpcqqskideailitwtkrfkasgv
    egadvvkllnkaikkrgdydanivavvndtvgtmmtcgyddqhcevgliigtgtnacyme
    elrhidlvegdegrmcintewgafgddgsledirtefdreidrgslnpgkqlfekmvsgm
    ylgelvrlilvkmakegllfegritpelltrgkfntsdvsaieknkeglhnakeiltrlg
    vepsdddcvsvqhvctivsfrsanlvaatlgailnrlrdnkgtprlrttvgvdgslykth
    pqysrrfhktlrrlvpdsdvrfllsesgsgkgaamvtavayrlaeqhrqieetlahfhlt
    kdmllevkkrmraemelglrkqthnnavvkmlpsfvrrtpdgtengdflaldlggtnfrv
    llvkirsgkkrtvemhnkiyaipieimqgtgeelfdhivscisdfldymgikgprmplgf
    tfsfpcqqtsldagilitwtkgfkatdcvghdvvtllrdaikrreefdldvvavvndtvg
    tmmtcayeeptcevglivgtgsnacymeemknvemvegdqgqmcinmewgafgdngcldd
    irthydrlvdeyslnagkqryekmisgmylgeivrnilidftkkgflfrgqisetlktrg
    ifetkflsqiesdrlallqvrailqqlglnstcddsilvktvcgvvsrraaqlcgagmaa
    vvdkirenrgldrlnvtvgvdgtlyklhphfsrimhqtvkelspkcnvsfllsedgsgkg
    aalitavgvrlrte
    

    Sequence, based on observed residues (ATOM records): (download)
    >4f9oA (A:)
    ddqvkkidkylyamrlsdetlidimtrfrkemknglsrdfnptatvkmlptfvrsipdgs
    ekgdfialdlggssfrilrvqvnheknqnvhmesevydtpenivhgsgsqlfdhvaeclg
    dfmekrkikdkklpvgftfsfpcqqskideailitwtkrfkasgvegadvvkllnkaikk
    rgdydanivavvndtvgtmmtcgyddqhcevgliigtgtnacymeelrhidlvegdegrm
    cintewgafgddgsledirtefdreidrgslnpgkqlfekmvsgmylgelvrlilvkmak
    egllfegritpelltrgkfntsdvsaieknkeglhnakeiltrlgvepsdddcvsvqhvc
    tivsfrsanlvaatlgailnrlrdnkgtprlrttvgvdgslykthpqysrrfhktlrrlv
    pdsdvrfllsesgsgkgaamvtavayrlaeqhrqieetlahfhltkdmllevkkrmraem
    elglrkqthnnavvkmlpsfvrrtpdgtengdflaldlggtnfrvllvkirsgkkrtvem
    hnkiyaipieimqgtgeelfdhivscisdfldymgikgprmplgftfsfpcqqtsldagi
    litwtkgfkatdcvghdvvtllrdaikrreefdldvvavvndtvgtmmtcayeeptcevg
    livgtgsnacymeemknvemvegdqgqmcinmewgafgdngclddirthydrlvdeysln
    agkqryekmisgmylgeivrnilidftkkgflfrgqisetlktrgifetkflsqiesdrl
    allqvrailqqlglnstcddsilvktvcgvvsrraaqlcgagmaavvdkirenrgldrln
    vtvgvdgtlyklhphfsrimhqtvkelspkcnvsfllsedgsgkgaalitavgvrlrte
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4f9oB (B:)
    miaaqllayyftelkddqvkkidkylyamrlsdetlidimtrfrkemknglsrdfnptat
    vkmlptfvrsipdgsekgdfialdlggssfrilrvqvnheknqnvhmesevydtpenivh
    gsgsqlfdhvaeclgdfmekrkikdkklpvgftfsfpcqqskideailitwtkrfkasgv
    egadvvkllnkaikkrgdydanivavvndtvgtmmtcgyddqhcevgliigtgtnacyme
    elrhidlvegdegrmcintewgafgddgsledirtefdreidrgslnpgkqlfekmvsgm
    ylgelvrlilvkmakegllfegritpelltrgkfntsdvsaieknkeglhnakeiltrlg
    vepsdddcvsvqhvctivsfrsanlvaatlgailnrlrdnkgtprlrttvgvdgslykth
    pqysrrfhktlrrlvpdsdvrfllsesgsgkgaamvtavayrlaeqhrqieetlahfhlt
    kdmllevkkrmraemelglrkqthnnavvkmlpsfvrrtpdgtengdflaldlggtnfrv
    llvkirsgkkrtvemhnkiyaipieimqgtgeelfdhivscisdfldymgikgprmplgf
    tfsfpcqqtsldagilitwtkgfkatdcvghdvvtllrdaikrreefdldvvavvndtvg
    tmmtcayeeptcevglivgtgsnacymeemknvemvegdqgqmcinmewgafgdngcldd
    irthydrlvdeyslnagkqryekmisgmylgeivrnilidftkkgflfrgqisetlktrg
    ifetkflsqiesdrlallqvrailqqlglnstcddsilvktvcgvvsrraaqlcgagmaa
    vvdkirenrgldrlnvtvgvdgtlyklhphfsrimhqtvkelspkcnvsfllsedgsgkg
    aalitavgvrlrte
    

    Sequence, based on observed residues (ATOM records): (download)
    >4f9oB (B:)
    ddqvkkidkylyamrlsdetlidimtrfrkemknglsrdfnptatvkmlptfvrsipdgs
    ekgdfialdlggssfrilrvqvnheknqnvhmesevydtpenivhgsgsqlfdhvaeclg
    dfmekrkikdkklpvgftfsfpcqqskideailitwtkrfkasgvegadvvkllnkaikk
    rgdydanivavvndtvgtmmtcgyddqhcevgliigtgtnacymeelrhidlvegdegrm
    cintewgafgddgsledirtefdreidrgslnpgkqlfekmvsgmylgelvrlilvkmak
    egllfegritpelltrgkfntsdvsaieknkeglhnakeiltrlgvepsdddcvsvqhvc
    tivsfrsanlvaatlgailnrlrdnkgtprlrttvgvdgslykthpqysrrfhktlrrlv
    pdsdvrfllsesgsgkgaamvtavayrlaeqhrqieetlahfhltkdmllevkkrmraem
    elglrkqthnnavvkmlpsfvrrtpdgtengdflaldlggtnfrvllvkirsgkkrtvem
    hnkiyaipieimqgtgeelfdhivscisdfldymgikgprmplgftfsfpcqqtsldagi
    litwtkgfkatdcvghdvvtllrdaikrreefdldvvavvndtvgtmmtcayeeptcevg
    livgtgsnacymeemknvemvegdqgqmcinmewgafgdngclddirthydrlvdeysln
    agkqryekmisgmylgeivrnilidftkkgflfrgqisetlktrgifetkflsqiesdrl
    allqvrailqqlglnstcddsilvktvcgvvsrraaqlcgagmaavvdkirenrgldrln
    vtvgvdgtlyklhphfsrimhqtvkelspkcnvsfllsedgsgkgaalitavgvrlrte