PDB entry 4f9n

View 4f9n on RCSB PDB site
Description: Crystal structure of the complex of type I Ribosome inactivating protein from Momordica balsamina with N7-methylated guanine at 2.65 A resolution
Class: Hydrolase
Keywords: N7-methylated guanine, Ligand binding, Hydrolase
Deposited on 2012-05-19, released 2012-06-20
The last revision prior to the SCOPe 2.05 freeze date was dated 2012-06-20, with a file datestamp of 2012-06-15.
Experiment type: XRAY
Resolution: 2.65 Å
R-factor: 0.169
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ribosome inactivating protein
    Species: Momordica balsamina [TaxId:3672]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4f9na_
  • Heterogens: MY6, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4f9nA (A:)
    dvsfrlsgadpssygmfikdlrnalphtekvyniplllpsvsgagryllmhlfnydgnti
    tvavdvtnvyimgylalttsyffnepaadlasqyvfrsarrkitlpysgnyerlqiaagk
    prekipiglpaldtaistllhydstaaagallvliqttaeaarfkyieqqiqerayrdev
    pssatislenswsglskqiqlaqgnngvfrtptvlvdskgnrvqitnvtsnvvtsniqll
    lntkni