PDB entry 4f95

View 4f95 on RCSB PDB site
Description: Crystal structure of human inosine triphosphate pyrophosphatase P32T variant
Class: hydrolase
Keywords: Hydrolase
Deposited on 2012-05-18, released 2013-04-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-06-12, with a file datestamp of 2013-06-07.
Experiment type: XRAY
Resolution: 2.07 Å
R-factor: 0.237
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: inosine triphosphate pyrophosphatase
    Species: Homo sapiens [TaxId:9606]
    Gene: C20orf37, ITPA, ITPA (P32T MUTANT), My049, OK/SW-cl.9
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9BY32
      • engineered mutation (34)
    Domains in SCOPe 2.07: d4f95a_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4f95A (A:)
    gshmaaslvgkkivfvtgnakkleevvqilgdkftctlvaqkidlpeyqgepdeisiqkc
    qeavrqvqgpvlvedtclcfnalgglpgpyikwfleklkpeglhqllagfedksayalct
    falstgdpsqpvrlfrgrtsgrivaprgcqdfgwdpcfqpdgyeqtyaempkaeknavsh
    rfrallelqeyfgslaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >4f95A (A:)
    aslvgkkivfvtgnakkleevvqilgdkftctlvaqkidlpeyqgepdeisiqkcqeavr
    qvqgpvlvedtclcfnalgglpgpyikwfleklkpeglhqllagfedksayalctfalst
    gdpsqpvrlfrgrtsgrivaprgcqdfgwdpcfqpdgyeqtyaempkaeknavshrfral
    lelqeyfgs