PDB entry 4f8c

View 4f8c on RCSB PDB site
Description: Structure of the Cif:Nedd8 complex - Yersinia pseudotuberculosis Cycle Inhibiting Factor in complex with human Nedd8
Class: cell cycle/protein binding
Keywords: Effector-Host target complex, Glutamine deamidase, Deamidation, BACTERIAL EFFECTOR, CELL CYCLE-PROTEIN BINDING complex
Deposited on 2012-05-17, released 2012-06-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-06-20, with a file datestamp of 2012-06-15.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.189
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cycle Inhibiting Factor
    Species: Yersinia pseudotuberculosis [TaxId:502800]
    Gene: YPK_1971
    Database cross-references and differences (RAF-indexed):
    • Uniprot B1JJZ9 (Start-274)
      • engineered mutation (103)
  • Chain 'B':
    Compound: nedd8
    Species: Homo sapiens [TaxId:9606]
    Gene: NEDD8
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4f8cb_
  • Chain 'C':
    Compound: Cycle Inhibiting Factor
    Species: Yersinia pseudotuberculosis [TaxId:502800]
    Gene: YPK_1971
    Database cross-references and differences (RAF-indexed):
    • Uniprot B1JJZ9
      • engineered mutation (103)
  • Chain 'D':
    Compound: nedd8
    Species: Homo sapiens [TaxId:9606]
    Gene: NEDD8
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4f8cd_
  • Heterogens: EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download) 
    >4f8cB (B:)
mlikvktltgkeieidieptdkverikerveekegippqqqrliysgkqmndektaadyk
ilggsvlhlvlalrgggglrqkhhhhhh

    Sequence, based on observed residues (ATOM records): (download) 
    >4f8cB (B:)
mlikvktltgkeieidieptdkverikerveekegippqqqrliysgkqmndektaadyk
ilggsvlhlvlalr

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    Sequence, based on SEQRES records: (download) 
    >4f8cD (D:)
mlikvktltgkeieidieptdkverikerveekegippqqqrliysgkqmndektaadyk
ilggsvlhlvlalrgggglrqkhhhhhh

    Sequence, based on observed residues (ATOM records): (download) 
    >4f8cD (D:)
mlikvktltgkeieidieptdkverikerveekegippqqqrliysgkqmndektaadyk
ilggsvlhlvlal