PDB entry 4f8c
View 4f8c on RCSB PDB site
Description: Structure of the Cif:Nedd8 complex - Yersinia pseudotuberculosis Cycle Inhibiting Factor in complex with human Nedd8
Class: cell cycle/protein binding
Keywords: Effector-Host target complex, Glutamine deamidase, Deamidation, BACTERIAL EFFECTOR, CELL CYCLE-PROTEIN BINDING complex
Deposited on
2012-05-17, released
2012-06-20
The last revision prior to the SCOPe 2.03 freeze date was dated
2012-06-20, with a file datestamp of
2012-06-15.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.189
AEROSPACI score: 0.45
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Cycle Inhibiting Factor
Species: Yersinia pseudotuberculosis [TaxId:502800]
Gene: YPK_1971
Database cross-references and differences (RAF-indexed):
- Uniprot B1JJZ9 (Start-274)
- engineered mutation (103)
- Chain 'B':
Compound: nedd8
Species: Homo sapiens [TaxId:9606]
Gene: NEDD8
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.03: d4f8cb_ - Chain 'C':
Compound: Cycle Inhibiting Factor
Species: Yersinia pseudotuberculosis [TaxId:502800]
Gene: YPK_1971
Database cross-references and differences (RAF-indexed):
- Uniprot B1JJZ9
- engineered mutation (103)
- Chain 'D':
Compound: nedd8
Species: Homo sapiens [TaxId:9606]
Gene: NEDD8
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.03: d4f8cd_ - Heterogens: EDO, HOH
PDB Chain Sequences:
- Chain 'A':
No sequence available.
- Chain 'B':
Sequence, based on SEQRES records: (download)
>4f8cB (B:)
mlikvktltgkeieidieptdkverikerveekegippqqqrliysgkqmndektaadyk
ilggsvlhlvlalrgggglrqkhhhhhh
Sequence, based on observed residues (ATOM records): (download)
>4f8cB (B:)
mlikvktltgkeieidieptdkverikerveekegippqqqrliysgkqmndektaadyk
ilggsvlhlvlalr
- Chain 'C':
No sequence available.
- Chain 'D':
Sequence, based on SEQRES records: (download)
>4f8cD (D:)
mlikvktltgkeieidieptdkverikerveekegippqqqrliysgkqmndektaadyk
ilggsvlhlvlalrgggglrqkhhhhhh
Sequence, based on observed residues (ATOM records): (download)
>4f8cD (D:)
mlikvktltgkeieidieptdkverikerveekegippqqqrliysgkqmndektaadyk
ilggsvlhlvlal