PDB entry 4f7g

View 4f7g on RCSB PDB site
Description: Crystal structure of talin autoinhibition complex
Class: cell adhesion
Keywords: alpha-helix bundle, integrin activation, CELL ADHESION
Deposited on 2012-05-16, released 2012-07-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-11-21, with a file datestamp of 2012-11-16.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: 0.212
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Talin-1
    Species: Mus musculus [TaxId:10090]
    Gene: Tln1, Tln
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4f7ga1, d4f7ga2
  • Chain 'B':
    Compound: Talin-1
    Species: Mus musculus [TaxId:10090]
    Gene: Tln1, Tln
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4f7gA (A:)
    mhhhhhhssgvdlgtenlyfqssrdpvqlnllyvqarddilngshpvsfdkacefagfqc
    qiqfgphneqkhkagfldlkdflpkeyvkqkgerkifqahkncgqmseieakvryvklar
    slktygvsfflvkekmkgknklvprllgitkecvmrvdektkeviqewsltnikrwaasp
    ksftldfgdyqdgyysvqttegeqiaqliagyidiilkkkks
    

    Sequence, based on observed residues (ATOM records): (download)
    >4f7gA (A:)
    pvqlnllyvqarddilngshpvsfdkacefagfqcqiqfgphneqkhkagfldlkdflpk
    eyvkqkgerkifqahkncgqmseieakvryvklarslktygvsfflvkekmkgknklvpr
    llgitkecvmrvdektkeviqewsltnikrwaaspksftldfgdyqdgyysvqttegeqi
    aqliagyidiil
    

  • Chain 'B':
    No sequence available.