PDB entry 4f7f

View 4f7f on RCSB PDB site
Description: Structure of Anopheles gambiae odorant binding protein 20
Class: odorant-binding protein
Keywords: insect, odoroant binding protein, transport, secreted, ODORANT-BINDING PROTEIN
Deposited on 2012-05-16, released 2012-10-17
The last revision prior to the SCOPe 2.02 freeze date was dated 2012-12-26, with a file datestamp of 2012-12-21.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.198
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: agap005208-pa
    Species: Anopheles gambiae [TaxId:7165]
    Gene: OBP20, AgaP_AGAP005208
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: agap005208-pa
    Species: Anopheles gambiae [TaxId:7165]
    Gene: OBP20, AgaP_AGAP005208
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: agap005208-pa
    Species: Anopheles gambiae [TaxId:7165]
    Gene: OBP20, AgaP_AGAP005208
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: agap005208-pa
    Species: Anopheles gambiae [TaxId:7165]
    Gene: OBP20, AgaP_AGAP005208
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d4f7fd_
  • Heterogens: 2PE, PG6, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4f7fD (D:)
    mtveqmmksgemirsvclgktkvaeelvnglreskfadvkelkcyvncvmemmqtmkkgk
    lnydasvkqidtimpdelagpmraaldicrtvadgiknncdaayvllqclsknnpkfifp
    

    Sequence, based on observed residues (ATOM records): (download)
    >4f7fD (D:)
    tveqmmksgemirsvclgktkvaeelvnglreskfadvkelkcyvncvmemmqtmkkgkl
    nydasvkqidtimpdelagpmraaldicrtvadgiknncdaayvllqclsknnpkfifp