PDB entry 4f6j

View 4f6j on RCSB PDB site
Description: Carbonmonoxy structure of His100Trp Cerebratulus lacteus mini-hemoglobin
Class: oxygen transport
Keywords: oxygen-storage, apolar tunnel, OXYGEN TRANSPORT
Deposited on 2012-05-14, released 2012-05-30
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-04-04, with a file datestamp of 2018-03-29.
Experiment type: XRAY
Resolution: 1.45 Å
R-factor: N/A
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: neural hemoglobin
    Species: CEREBRATULUS LACTEUS [TaxId:6221]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O76242 (0-109)
      • engineered mutation (100)
    Domains in SCOPe 2.08: d4f6ja_
  • Heterogens: HEM, CMO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4f6jA (A:)
    mvnwaavvddfyqelfkahpeyqnkfgfkgvalgslkgnaayktqagktvdyinaaiggs
    adaaglasrhkgrnvgsaefhnakaclakacsahgapdlgwaiddilshl