PDB entry 4f6g

View 4f6g on RCSB PDB site
Description: Aquomet Structure of His100Trp Cerebratulus lacteus mini-hemoglobin
Class: oxygen transport
Keywords: oxygen-storage, apolar tunnel, OXYGEN TRANSPORT
Deposited on 2012-05-14, released 2012-05-30
The last revision prior to the SCOPe 2.06 freeze date was dated 2012-05-30, with a file datestamp of 2012-05-25.
Experiment type: XRAY
Resolution: 1.64 Å
R-factor: 0.186
AEROSPACI score: 0.6 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: neural hemoglobin
  Species: CEREBRATULUS LACTEUS [TaxId:6221]
  Database cross-references and differences (RAF-indexed):
  • Uniprot O76242 (0-109)
    • engineered mutation (100)
  Domains in SCOPe 2.06: d4f6ga_
• Heterogens: HEM, SO4, GOL, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >4f6gA (A:)
  mvnwaavvddfyqelfkahpeyqnkfgfkgvalgslkgnaayktqagktvdyinaaiggs
  adaaglasrhkgrnvgsaefhnakaclakacsahgapdlgwaiddilshl