PDB entry 4f68

View 4f68 on RCSB PDB site
Description: Oxy structure of Tyr11Phe/Gln44Leu/Thr48Val/Ala55Trp Cerebratulus lacteus mini-hemoglobin
Class: oxygen transport
Keywords: oxygen-storage, apolar tunnel, OXYGEN TRANSPORT
Deposited on 2012-05-14, released 2012-05-30
The last revision prior to the SCOPe 2.05 freeze date was dated 2012-05-30, with a file datestamp of 2012-05-25.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.203
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: neural hemoglobin
    Species: CEREBRATULUS LACTEUS [TaxId:6221]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O76242 (0-109)
      • engineered mutation (11)
      • engineered mutation (44)
      • engineered mutation (48)
      • engineered mutation (55)
    Domains in SCOPe 2.05: d4f68a_
  • Heterogens: HEM, OXY, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4f68A (A:)
mvnwaavvddffqelfkahpeyqnkfgfkgvalgslkgnaayktlagkvvdyinawiggs
adaaglasrhkgrnvgsaefhnakaclakacsahgapdlghaiddilshl