PDB entry 4f5s

View 4f5s on RCSB PDB site
Description: Crystal Structure of Bovine Serum Albumin
Class: transport protein
Keywords: bovine serum albumin, TRANSPORT PROTEIN
Deposited on 2012-05-13, released 2012-10-03
The last revision prior to the SCOPe 2.04 freeze date was dated 2012-10-03, with a file datestamp of 2012-09-28.
Experiment type: XRAY
Resolution: 2.47 Å
R-factor: 0.199
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: serum albumin
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02769 (0-582)
      • varaint (189)
      • variant (189)
    Domains in SCOPe 2.04: d4f5sa1, d4f5sa2, d4f5sa3
  • Chain 'B':
    Compound: serum albumin
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02769 (0-582)
      • varaint (189)
      • variant (189)
    Domains in SCOPe 2.04: d4f5sb1, d4f5sb2, d4f5sb3
  • Heterogens: PGE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4f5sA (A:)
    dthkseiahrfkdlgeehfkglvliafsqylqqcpfdehvklvneltefaktcvadesha
    gcekslhtlfgdelckvaslretygdmadccekqepernecflshkddspdlpklkpdpn
    tlcdefkadekkfwgkylyeiarrhpyfyapellyyankyngvfqeccqaedkgacllpk
    ietmrekvltssarqrlrcasiqkfgeralkawsvarlsqkfpkaefvevtklvtdltkv
    hkecchgdllecaddradlakyicdnqdtissklkeccdkpllekshciaevekdaipen
    lppltadfaedkdvcknyqeakdaflgsflyeysrrhpeyavsvllrlakeyeatleecc
    akddphacystvfdklkhlvdepqnlikqncdqfeklgeygfqnalivrytrkvpqvstp
    tlvevsrslgkvgtrcctkpesermpctedylslilnrlcvlhektpvsekvtkcctesl
    vnrrpcfsaltpdetyvpkafdeklftfhadictlpdtekqikkqtalvellkhkpkate
    eqlktvmenfvafvdkccaaddkeacfavegpklvvstqtala
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4f5sB (B:)
    dthkseiahrfkdlgeehfkglvliafsqylqqcpfdehvklvneltefaktcvadesha
    gcekslhtlfgdelckvaslretygdmadccekqepernecflshkddspdlpklkpdpn
    tlcdefkadekkfwgkylyeiarrhpyfyapellyyankyngvfqeccqaedkgacllpk
    ietmrekvltssarqrlrcasiqkfgeralkawsvarlsqkfpkaefvevtklvtdltkv
    hkecchgdllecaddradlakyicdnqdtissklkeccdkpllekshciaevekdaipen
    lppltadfaedkdvcknyqeakdaflgsflyeysrrhpeyavsvllrlakeyeatleecc
    akddphacystvfdklkhlvdepqnlikqncdqfeklgeygfqnalivrytrkvpqvstp
    tlvevsrslgkvgtrcctkpesermpctedylslilnrlcvlhektpvsekvtkcctesl
    vnrrpcfsaltpdetyvpkafdeklftfhadictlpdtekqikkqtalvellkhkpkate
    eqlktvmenfvafvdkccaaddkeacfavegpklvvstqtala