PDB entry 4f5i

View 4f5i on RCSB PDB site
Description: Substrate Specificity Conversion of E. coli Pyridoxal-5'-Phosphate Dependent Aspartate Aminotransferase to Tyrosine Aminotransferase: Chimera P4.
Class: Transferase
Keywords: Aminotransferase, Transferase
Deposited on 2012-05-13, released 2013-02-13
The last revision prior to the SCOPe 2.06 freeze date was dated 2013-04-24, with a file datestamp of 2013-04-19.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.175
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: aspartate aminotransferase
    Species: Escherichia coli [TaxId:83333]
    Gene: AAT, aspC, b0928, JW0911
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00509 (11-405)
      • expression tag (6-10)
      • engineered mutation (38-39)
      • engineered mutation (42)
      • engineered mutation (55)
      • engineered mutation (73)
      • engineered mutation (113)
      • engineered mutation (138)
      • engineered mutation (144-145)
      • engineered mutation (219)
      • engineered mutation (221)
      • engineered mutation (227)
      • engineered mutation (253)
      • engineered mutation (258)
      • engineered mutation (294)
      • engineered mutation (384)
    Domains in SCOPe 2.06: d4f5ia1, d4f5ia2
  • Chain 'B':
    Compound: aspartate aminotransferase
    Species: Escherichia coli [TaxId:83333]
    Gene: AAT, aspC, b0928, JW0911
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00509 (11-405)
      • expression tag (6-10)
      • engineered mutation (38-39)
      • engineered mutation (42)
      • engineered mutation (55)
      • engineered mutation (73)
      • engineered mutation (113)
      • engineered mutation (138)
      • engineered mutation (144-145)
      • engineered mutation (219)
      • engineered mutation (221)
      • engineered mutation (227)
      • engineered mutation (253)
      • engineered mutation (258)
      • engineered mutation (294)
      • engineered mutation (384)
    Domains in SCOPe 2.06: d4f5ib1, d4f5ib2
  • Heterogens: MPD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4f5iA (A:)
    mahhhhhhvgtfenitaapadpilgladlfraderpgkvdlgvgvykdetgktpvmtsvk
    kaeqyllenettktylgidgipefgrctqellfgkgsalindkrartaqtpggsgalrva
    adflakntsvkrvwvsnptwpnhkaifnsaglevreyayydaenhtldfdalinslneaq
    agdvvlfhgcchnptgidptleqwqtlaqlsvekgwlplidiayqgfgrgleedaeglra
    faamhkelivasscsknfslynervgactlvaadsetvdrafsqmkaairanyssppahg
    asvvatilsndalraiweqeltdmrqriqrmrqlfvntlqekganrdfsfiikqngmfsf
    sgltkeqvlrlreefgvyavasgrinvagmtpdnmaplceaivavl
    

    Sequence, based on observed residues (ATOM records): (download)
    >4f5iA (A:)
    hhvgtfenitaapadpilgladlfraderpgkvdlgvgvykdetgktpvmtsvkkaeqyl
    lenettktylgidgipefgrctqellfgkgsalindkrartaqtpggsgalrvaadflak
    ntsvkrvwvsnptwpnhkaifnsaglevreyayydaenhtldfdalinslneaqagdvvl
    fhgcchnptgidptleqwqtlaqlsvekgwlplidiayqgfgrgleedaeglrafaamhk
    elivasscsknfslynervgactlvaadsetvdrafsqmkaairanyssppahgasvvat
    ilsndalraiweqeltdmrqriqrmrqlfvntlqekganrdfsfiikqngmfsfsgltke
    qvlrlreefgvyavasgrinvagmtpdnmaplceaivavl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4f5iB (B:)
    mahhhhhhvgtfenitaapadpilgladlfraderpgkvdlgvgvykdetgktpvmtsvk
    kaeqyllenettktylgidgipefgrctqellfgkgsalindkrartaqtpggsgalrva
    adflakntsvkrvwvsnptwpnhkaifnsaglevreyayydaenhtldfdalinslneaq
    agdvvlfhgcchnptgidptleqwqtlaqlsvekgwlplidiayqgfgrgleedaeglra
    faamhkelivasscsknfslynervgactlvaadsetvdrafsqmkaairanyssppahg
    asvvatilsndalraiweqeltdmrqriqrmrqlfvntlqekganrdfsfiikqngmfsf
    sgltkeqvlrlreefgvyavasgrinvagmtpdnmaplceaivavl
    

    Sequence, based on observed residues (ATOM records): (download)
    >4f5iB (B:)
    hhvgtfenitaapadpilgladlfraderpgkvdlgvgvykdetgktpvmtsvkkaeqyl
    lenettktylgidgipefgrctqellfgkgsalindkrartaqtpggsgalrvaadflak
    ntsvkrvwvsnptwpnhkaifnsaglevreyayydaenhtldfdalinslneaqagdvvl
    fhgcchnptgidptleqwqtlaqlsvekgwlplidiayqgfgrgleedaeglrafaamhk
    elivasscsknfslynervgactlvaadsetvdrafsqmkaairanyssppahgasvvat
    ilsndalraiweqeltdmrqriqrmrqlfvntlqekganrdfsfiikqngmfsfsgltke
    qvlrlreefgvyavasgrinvagmtpdnmaplceaivavl