PDB entry 4f59
View 4f59 on RCSB PDB site
Description: Triple mutant Src SH2 domain
Class: protein binding
Keywords: SH2 domain, cell signalling, phosphotyrosine binding, PROTEIN BINDING
Deposited on
2012-05-12, released
2012-10-03
The last revision prior to the SCOPe 2.04 freeze date was dated
2012-10-03, with a file datestamp of
2012-09-28.
Experiment type: XRAY
Resolution: 1.71 Å
R-factor: 0.206
AEROSPACI score: 0.52
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Proto-oncogene tyrosine-protein kinase Src
Species: Homo sapiens [TaxId:9606]
Gene: SRC, SRC1
Database cross-references and differences (RAF-indexed):
- Uniprot P12931 (3-End)
- engineered mutation (42)
- engineered mutation (47)
- engineered mutation (65)
Domains in SCOPe 2.04: d4f59a_ - Heterogens: HOH
PDB Chain Sequences:
- Chain 'A':
Sequence, based on SEQRES records: (download)
>4f59A (A:)
gamdsiqaeewyfgkitrreserlllnaenprgtflvresetvkgayalsvsdfdnakgl
nvkhylirkldsggfyitsrtqfnslqqlvayyskhadglchrlttvcptsk
Sequence, based on observed residues (ATOM records): (download)
>4f59A (A:)
dsiqaeewyfgkitrreserlllnaenprgtflvresetvkgayalsvsdfdnakglnvk
hylirkldsggfyitsrtqfnslqqlvayyskhadglchrlttvcpts