PDB entry 4f58

View 4f58 on RCSB PDB site
Description: Fab structure of a neutralizing antibody L3 from an early subtype A HIV-1 infected patient
Class: immune system
Keywords: Ig, antibody, gp120, IMMUNE SYSTEM
Deposited on 2012-05-12, released 2013-03-27
The last revision prior to the SCOPe 2.03 freeze date was dated 2013-03-27, with a file datestamp of 2013-03-22.
Experiment type: XRAY
Resolution: 2.49 Å
R-factor: 0.21
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: Heavy chain of Fab of a neutralizing antibody L3
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4F58 (0-225)
  • Chain 'I':
    Compound: Heavy chain of Fab of a neutralizing antibody L3
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4F58 (0-225)
  • Chain 'J':
    Compound: Heavy chain of Fab of a neutralizing antibody L3
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4F58 (0-225)
  • Chain 'K':
    Compound: Heavy chain of Fab of a neutralizing antibody L3
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4F58 (0-225)
  • Chain 'L':
    Compound: Light chain of Fab of a neutralizing antibody L3
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4F58 (0-212)
    Domains in SCOPe 2.03: d4f58l1, d4f58l2
  • Chain 'M':
    Compound: Light chain of Fab of a neutralizing antibody L3
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4F58 (0-212)
    Domains in SCOPe 2.03: d4f58m1, d4f58m2
  • Chain 'N':
    Compound: Light chain of Fab of a neutralizing antibody L3
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4F58 (0-212)
    Domains in SCOPe 2.03: d4f58n1, d4f58n2
  • Chain 'O':
    Compound: Light chain of Fab of a neutralizing antibody L3
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4F58 (0-212)
    Domains in SCOPe 2.03: d4f58o1, d4f58o2
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'H':
    No sequence available.

  • Chain 'I':
    No sequence available.

  • Chain 'J':
    No sequence available.

  • Chain 'K':
    No sequence available.

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4f58L (L:)
qsaltqpasvsgspgqsitisctgttsdvgtynfvswyqqhpgkapkaiifdvtnrpsgi
snrfsgskfgntasltisglqaedeadyycaaytvastllfgggtkvtvlrqpkaapsvt
lfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaass
ylsltpeqwkshrsyscqvthegstvektvapt

  • Chain 'M':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4f58M (M:)
qsaltqpasvsgspgqsitisctgttsdvgtynfvswyqqhpgkapkaiifdvtnrpsgi
snrfsgskfgntasltisglqaedeadyycaaytvastllfgggtkvtvlrqpkaapsvt
lfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaass
ylsltpeqwkshrsyscqvthegstvektvapt

  • Chain 'N':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4f58N (N:)
qsaltqpasvsgspgqsitisctgttsdvgtynfvswyqqhpgkapkaiifdvtnrpsgi
snrfsgskfgntasltisglqaedeadyycaaytvastllfgggtkvtvlrqpkaapsvt
lfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaass
ylsltpeqwkshrsyscqvthegstvektvapt

  • Chain 'O':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4f58O (O:)
qsaltqpasvsgspgqsitisctgttsdvgtynfvswyqqhpgkapkaiifdvtnrpsgi
snrfsgskfgntasltisglqaedeadyycaaytvastllfgggtkvtvlrqpkaapsvt
lfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaass
ylsltpeqwkshrsyscqvthegstvektvapt