PDB entry 4f57

View 4f57 on RCSB PDB site
Description: Fab structure of a neutralizing antibody L1 from an early subtype A HIV-1 infected patient
Class: immune system
Keywords: Ig, antibody, gp120, IMMUNE SYSTEM
Deposited on 2012-05-12, released 2013-03-27
The last revision prior to the SCOPe 2.06 freeze date was dated 2013-03-27, with a file datestamp of 2013-03-22.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.188
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: Heavy chain of Fab of a neutralizing antibody L1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4F57 (0-End)
  • Chain 'L':
    Compound: Light chain of Fab of a neutralizing antibody L1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4F57 (0-212)
    Domains in SCOPe 2.06: d4f57l1, d4f57l2
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4f57L (L:)
    qsaltqpasvsgspgqsitisctgtssdvggynyvswyrqhpgeapkaiifdvtnrpsgi
    snrfsgskfgntasltisglqaedeadyycaaytvastllfgggtkvtvlrqpkaapsvt
    lfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaass
    ylsltpeqwkshrsyscqvthegstvektvapt