PDB entry 4f4p

View 4f4p on RCSB PDB site
Description: SYK in COMPLEX WITH LIGAND LASW836
Class: transferase/transferase inhibitor
Keywords: Tyrosine-protein kinase, TRANSFERASE, TRANSFERASE-TRANSFERASE INHIBITOR complex
Deposited on 2012-05-11, released 2012-12-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-12-12, with a file datestamp of 2012-12-07.
Experiment type: XRAY
Resolution: 2.37 Å
R-factor: 0.241
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tyrosine-protein kinase SYK
    Species: Homo sapiens [TaxId:9606]
    Gene: SYK
    Database cross-references and differences (RAF-indexed):
    • Uniprot P43405 (0-270)
      • expression tag (271-272)
    Domains in SCOPe 2.07: d4f4pa1, d4f4pa2
  • Heterogens: 0SB, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4f4pA (A:)
    ldrklltledkelgsgnfgtvkkgyyqmkkvvktvavkilkneandpalkdellaeanvm
    qqldnpyivrmigiceaeswmlvmemaelgplnkylqqnrhvkdkniielvhqvsmgmky
    leesnfvhrdlaarnvllvtqhyakisdfglskalradenyykaqthgkwpvkwyapeci
    nyykfssksdvwsfgvlmweafsygqkpyrgmkgsevtamlekgermgcpagcpremydl
    mnlcwtydvenrpgfaavelrlrnyyydvvneg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4f4pA (A:)
    ldrklltledkelgsgnfgtvkkgyvktvavkilkpalkdellaeanvmqqldnpyivrm
    igiceaeswmlvmemaelgplnkylqqnrhvkdkniielvhqvsmgmkyleesnfvhrdl
    aarnvllvtqhyakisdfglskalradenyykaqthgkwpvkwyapecinyykfssksdv
    wsfgvlmweafsygqkpyrgmkgsevtamlekgermgcpagcpremydlmnlcwtydven
    rpgfaavelrlrnyyydvvneg