PDB entry 4f4o

View 4f4o on RCSB PDB site
Description: Structure of the Haptoglobin-Haemoglobin Complex
Class: oxygen transport/transport protein
Keywords: Globin Fold, Serine Protease Fold, Complement Control Protein, Haemoglobin scavenging, OXYGEN STORAGE-TRANSPORT complex, OXYGEN TRANSPORT-TRANSPORT PROTEIN complex
Deposited on 2012-05-11, released 2012-08-29
The last revision prior to the SCOPe 2.04 freeze date was dated 2012-09-26, with a file datestamp of 2012-09-21.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.212
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hemoglobin subunit alpha
    Species: Sus scrofa [TaxId:9823]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d4f4oa_
  • Chain 'B':
    Compound: Hemoglobin subunit beta
    Species: Sus scrofa [TaxId:9823]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d4f4ob_
  • Chain 'C':
    Compound: Haptoglobin
    Species: Sus scrofa [TaxId:9823]
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: Hemoglobin subunit alpha
    Species: Sus scrofa [TaxId:9823]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d4f4od_
  • Chain 'E':
    Compound: Hemoglobin subunit beta
    Species: Sus scrofa [TaxId:9823]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d4f4oe_
  • Chain 'F':
    Compound: Haptoglobin
    Species: Sus scrofa [TaxId:9823]
    Database cross-references and differences (RAF-indexed):
  • Chain 'G':
    Compound: Hemoglobin subunit alpha
    Species: Sus scrofa [TaxId:9823]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d4f4og_
  • Chain 'H':
    Compound: Hemoglobin subunit beta
    Species: Sus scrofa [TaxId:9823]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d4f4oh_
  • Chain 'I':
    Compound: Haptoglobin
    Species: Sus scrofa [TaxId:9823]
    Database cross-references and differences (RAF-indexed):
  • Chain 'J':
    Compound: Hemoglobin subunit alpha
    Species: Sus scrofa [TaxId:9823]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d4f4oj_
  • Chain 'K':
    Compound: Hemoglobin subunit beta
    Species: Sus scrofa [TaxId:9823]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d4f4ok_
  • Chain 'L':
    Compound: Haptoglobin
    Species: Sus scrofa [TaxId:9823]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HEM, OXY, NAG

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4f4oA (A:)
    vlsaadkanvkaawgkvggqagahgaealermflgfpttktyfphfnlshgsdqvkahgq
    kvadaltkavghlddlpgalsalsdlhahklrvdpvnfkllshcllvtlaahhpddfnps
    vhasldkflanvstvltskyr
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4f4oB (B:)
    vhlsaeekeavlglwgkvnvdevggealgrllvvypwtqrffesfgdlsnadavmgnpkv
    kahgkkvlqsfsdglkhldnlkgtfaklselhcdqlhvdpenfrllgnvivvvlarrlgh
    dfnpnvqaafqkvvagvanalahkyh
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4f4oD (D:)
    vlsaadkanvkaawgkvggqagahgaealermflgfpttktyfphfnlshgsdqvkahgq
    kvadaltkavghlddlpgalsalsdlhahklrvdpvnfkllshcllvtlaahhpddfnps
    vhasldkflanvstvltskyr
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4f4oE (E:)
    vhlsaeekeavlglwgkvnvdevggealgrllvvypwtqrffesfgdlsnadavmgnpkv
    kahgkkvlqsfsdglkhldnlkgtfaklselhcdqlhvdpenfrllgnvivvvlarrlgh
    dfnpnvqaafqkvvagvanalahkyh
    

  • Chain 'F':
    No sequence available.

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4f4oG (G:)
    vlsaadkanvkaawgkvggqagahgaealermflgfpttktyfphfnlshgsdqvkahgq
    kvadaltkavghlddlpgalsalsdlhahklrvdpvnfkllshcllvtlaahhpddfnps
    vhasldkflanvstvltskyr
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4f4oH (H:)
    vhlsaeekeavlglwgkvnvdevggealgrllvvypwtqrffesfgdlsnadavmgnpkv
    kahgkkvlqsfsdglkhldnlkgtfaklselhcdqlhvdpenfrllgnvivvvlarrlgh
    dfnpnvqaafqkvvagvanalahkyh
    

  • Chain 'I':
    No sequence available.

  • Chain 'J':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4f4oJ (J:)
    vlsaadkanvkaawgkvggqagahgaealermflgfpttktyfphfnlshgsdqvkahgq
    kvadaltkavghlddlpgalsalsdlhahklrvdpvnfkllshcllvtlaahhpddfnps
    vhasldkflanvstvltskyr
    

  • Chain 'K':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4f4oK (K:)
    vhlsaeekeavlglwgkvnvdevggealgrllvvypwtqrffesfgdlsnadavmgnpkv
    kahgkkvlqsfsdglkhldnlkgtfaklselhcdqlhvdpenfrllgnvivvvlarrlgh
    dfnpnvqaafqkvvagvanalahkyh
    

  • Chain 'L':
    No sequence available.