PDB entry 4f4e

View 4f4e on RCSB PDB site
Description: Crystal structure of Aromatic-amino-acid aminotransferase from Burkholderia pseudomallei covalently bound to pyridoxal phosphate
Class: transferase
Keywords: SSGCID, Structural Genomics, Seattle Structural Genomics Center for Infectious Disease, pyridoxal phosphate lysine, TRANSFERASE
Deposited on 2012-05-10, released 2012-05-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-05-25, with a file datestamp of 2016-05-20.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Aromatic-amino-acid aminotransferase
    Species: BURKHOLDERIA PSEUDOMALLEI [TaxId:272560]
    Gene: BPSS0355, tyrB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4f4ea_
  • Chain 'B':
    Compound: Aromatic-amino-acid aminotransferase
    Species: BURKHOLDERIA PSEUDOMALLEI [TaxId:272560]
    Gene: BPSS0355, tyrB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4f4eb_
  • Heterogens: EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4f4eA (A:)
    mahhhhhhmgtleaqtqgpgsmslfsavelaprdpilglneafnadtrptkvnlgvgvyt
    nedgkipllravrdaekarveaglprgylpidgiaaydasvqklllgddspliaagrvvt
    aqalggtgalkigadflrtlnpkakvaisdpswenhralfdmagfevvaypyydaktngv
    nfdgmlaalngyepgtivvlhacchnptgvdlndaqwaqvvevvkarrlvpfldiayqgf
    gesieadaaavrlfaaanlnvfvsssfsksfslygervgalsiitdskdeaarvlsqlkr
    virtnysnppthggaivaavlaspelraswvqelgemrdriramrnglverlkaagierd
    fsfinaqrgmfsysgltsaqvdrlreefgiyavstgricvaalntrnldvvanaiaavlk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4f4eA (A:)
    mslfsavelaprdpilglneafnadtrptkvnlgvgvytnedgkipllravrdaekarve
    aglprgylpidgiaaydasvqklllgddspliaagrvvtaqalggtgalkigadflrtln
    pkakvaisdpswenhralfdmagfevvaypyydaktngvnfdgmlaalngyepgtivvlh
    acchnptgvdlndaqwaqvvevvkarrlvpfldiayqgfgesieadaaavrlfaaanlnv
    fvsssfsksfslygervgalsiitdskdeaarvlsqlkrvirtnysnppthggaivaavl
    aspelraswvqelgemrdriramrnglverlkaagierdfsfinaqrgmfsysgltsaqv
    drlreefgiyavstgricvaalntrnldvvanaiaavlk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4f4eB (B:)
    mahhhhhhmgtleaqtqgpgsmslfsavelaprdpilglneafnadtrptkvnlgvgvyt
    nedgkipllravrdaekarveaglprgylpidgiaaydasvqklllgddspliaagrvvt
    aqalggtgalkigadflrtlnpkakvaisdpswenhralfdmagfevvaypyydaktngv
    nfdgmlaalngyepgtivvlhacchnptgvdlndaqwaqvvevvkarrlvpfldiayqgf
    gesieadaaavrlfaaanlnvfvsssfsksfslygervgalsiitdskdeaarvlsqlkr
    virtnysnppthggaivaavlaspelraswvqelgemrdriramrnglverlkaagierd
    fsfinaqrgmfsysgltsaqvdrlreefgiyavstgricvaalntrnldvvanaiaavlk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4f4eB (B:)
    mslfsavelaprdpilglneafnadtrptkvnlgvgvytnedgkipllravrdaekarve
    aglprgylpidgiaaydasvqklllgddspliaagrvvtaqalggtgalkigadflrtln
    pkakvaisdpswenhralfdmagfevvaypyydaktngvnfdgmlaalngyepgtivvlh
    acchnptgvdlndaqwaqvvevvkarrlvpfldiayqgfgesieadaaavrlfaaanlnv
    fvsssfsksfslygervgalsiitdskdeaarvlsqlkrvirtnysnppthggaivaavl
    aspelraswvqelgemrdriramrnglverlkaagierdfsfinaqrgmfsysgltsaqv
    drlreefgiyavstgricvaalntrnldvvanaiaavlk