PDB entry 4f33

View 4f33 on RCSB PDB site
Description: Crystal Structure of therapeutic antibody MORAb-009
Class: immune system
Keywords: IgG, Antigen binding, Mesothelin, IMMUNE SYSTEM
Deposited on 2012-05-08, released 2012-07-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-03-26, with a file datestamp of 2014-03-21.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.208
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: MORAb-009 Fab light chain
    Species: Mus musculus [TaxId:10090]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 4F33 (0-End)
    Domains in SCOPe 2.07: d4f33a1, d4f33a2
  • Chain 'B':
    Compound: MORAb-009 Fab heavy chain
    Species: Mus musculus [TaxId:10090]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 4F33 (0-End)
  • Chain 'C':
    Compound: MORAb-009 Fab light chain
    Species: Mus musculus [TaxId:10090]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 4F33 (0-End)
    Domains in SCOPe 2.07: d4f33c1, d4f33c2
  • Chain 'D':
    Compound: MORAb-009 Fab heavy chain
    Species: Mus musculus [TaxId:10090]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 4F33 (0-End)
  • Chain 'E':
    Compound: MORAb-009 Fab light chain
    Species: Mus musculus [TaxId:10090]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 4F33 (0-End)
    Domains in SCOPe 2.07: d4f33e1, d4f33e2
  • Chain 'F':
    Compound: MORAb-009 Fab heavy chain
    Species: Mus musculus [TaxId:10090]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 4F33 (0-End)
  • Chain 'G':
    Compound: MORAb-009 Fab light chain
    Species: Mus musculus [TaxId:10090]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 4F33 (0-End)
    Domains in SCOPe 2.07: d4f33g1, d4f33g2
  • Chain 'H':
    Compound: MORAb-009 Fab heavy chain
    Species: Mus musculus [TaxId:10090]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 4F33 (0-End)
  • Heterogens: PG4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4f33A (A:)
    dieltqspaimsaspgekvtmtcsasssvsymhwyqqksgtspkrwiydtsklasgvpgr
    fsgsgsgnsysltissveaeddatyycqqwskhpltfgsgtkveikrtvaapsvfifpps
    deqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstltl
    skadyekhkvyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >4f33A (A:)
    dieltqspaimsaspgekvtmtcsasssvsymhwyqqksgtspkrwiydtsklasgvpgr
    fsgsgsgnsysltissveaeddatyycqqwskhpltfgsgtkveikrtvaapsvfifpps
    deqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstltl
    skadyekhkvyacevthqglsspvtksfnrg
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4f33C (C:)
    dieltqspaimsaspgekvtmtcsasssvsymhwyqqksgtspkrwiydtsklasgvpgr
    fsgsgsgnsysltissveaeddatyycqqwskhpltfgsgtkveikrtvaapsvfifpps
    deqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstltl
    skadyekhkvyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >4f33C (C:)
    dieltqspaimsaspgekvtmtcsasssvsymhwyqqksgtspkrwiydtsklasgvpgr
    fsgsgsgnsysltissveaeddatyycqqwskhpltfgsgtkveikrtvaapsvfifpps
    deqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstltl
    skadyekhkvyacevthqglsspvtksfnrg
    

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4f33E (E:)
    dieltqspaimsaspgekvtmtcsasssvsymhwyqqksgtspkrwiydtsklasgvpgr
    fsgsgsgnsysltissveaeddatyycqqwskhpltfgsgtkveikrtvaapsvfifpps
    deqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstltl
    skadyekhkvyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >4f33E (E:)
    dieltqspaimsaspgekvtmtcsasssvsymhwyqqksgtspkrwiydtsklasgvpgr
    fsgsgsgnsysltissveaeddatyycqqwskhpltfgsgtkveikrtvaapsvfifpps
    deqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstltl
    skadyekhkvyacevthqglsspvtksfnrg
    

  • Chain 'F':
    No sequence available.

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >4f33G (G:)
    dieltqspaimsaspgekvtmtcsasssvsymhwyqqksgtspkrwiydtsklasgvpgr
    fsgsgsgnsysltissveaeddatyycqqwskhpltfgsgtkveikrtvaapsvfifpps
    deqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstltl
    skadyekhkvyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >4f33G (G:)
    dieltqspaimsaspgekvtmtcsasssvsymhwyqqksgtspkrwiydtsklasgvpgr
    fsgsgsgnsysltissveaeddatyycqqwskhpltfgsgtkveikrtvaapsvfifpps
    deqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstltl
    skadyekhkvyacevthqglsspvtksfnrg
    

  • Chain 'H':
    No sequence available.