PDB entry 4f2d

View 4f2d on RCSB PDB site
Description: Crystal Structure of Escherichia coli L-arabinose Isomerase (ECAI) complexed with Ribitol
Class: isomerase
Keywords: Structural Genomics, PSI-1, Protein Structure Initiative, New York SGX Research Center for Structural Genomics, NYSGXRC, ISOMERASE, Sugar Binding
Deposited on 2012-05-07, released 2012-05-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-05-30, with a file datestamp of 2012-05-25.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.214
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: L-arabinose isomerase
    Species: Escherichia coli [TaxId:83333]
    Gene: araA, b0062, JW0061, UTI89_C0067
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08202 (0-End)
      • conflict (247)
      • conflict (359)
    Domains in SCOPe 2.07: d4f2da1, d4f2da2
  • Chain 'B':
    Compound: L-arabinose isomerase
    Species: Escherichia coli [TaxId:83333]
    Gene: araA, b0062, JW0061, UTI89_C0067
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08202 (0-End)
      • conflict (247)
      • conflict (359)
    Domains in SCOPe 2.07: d4f2db1, d4f2db2
  • Chain 'C':
    Compound: L-arabinose isomerase
    Species: Escherichia coli [TaxId:83333]
    Gene: araA, b0062, JW0061, UTI89_C0067
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08202 (0-End)
      • conflict (247)
      • conflict (359)
    Domains in SCOPe 2.07: d4f2dc1, d4f2dc2
  • Heterogens: MN, RB0, ACY, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4f2dA (A:)
    mtifdnyevwfvigsqhlygpetlrqvtqhaehvvnalnteaklpcklvlkplgttpdei
    taicrdanyddrcaglvvwlhtfspakmwingltmlnkpllqfhtqfnaalpwdsidmdf
    mnlnqtahggrefgfigarmrqqhavvtghwqdkqaherigswmrqavskqdtrhlkvcr
    fgdnmrevavtdgdkvaaqikfgfsvntwavgdlvqvvnsisdgdvnalvdeyescytmt
    patqihgekrqnvleaarielgmkrfleqggfhaftttfedlhglkqlpglavqrlmqqg
    ygfagegdwktaallrimkvmstglqggtsfmedytyhfekgndlvlgshmlevcpsiav
    eekpildvqhlgiggkddparlifntqtgpaivaslidlgdryrllvncidtvktphslp
    klpvanalwkaqpdlptaseawilaggahhtvfshalnlndmrqfaemhdieitvidndt
    rlpafkdalrwnevyygfrr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4f2dA (A:)
    mtifdnyevwfvigsqhlygpetlrqvtqhaehvvnalnteaklpcklvlkplgttpdei
    taicrdanyddrcaglvvwlhtfspakmwingltmlnkpllqfhtqfnaalpwdsidmdf
    mnlnqtahggrefgfigarmrqqhavvtghwqdkqaherigswmrqavskqdtrhlkvcr
    fgdnmrevavtdgdkvaaqikfgfsvntwavgdlvqvvnsisdgdvnalvdeyescytmt
    patqihgekrqnvleaarielgmkrfleqggfhaftttfedlhglkqlpglavqrlmqqg
    ygfagegdwktaallrimkvmstglqggtsfmedytyhfekgndlvlgshmlevcpsiav
    eekpildvqhlgiggkddparlifntqtgpaivaslidlgdryrllvncidtvktphslp
    klpvanalwkaqpdlptaseawilaggahhtvfshalnlndmrqfaemhdieitvidndt
    rlpafkdalrwnevyygf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4f2dB (B:)
    mtifdnyevwfvigsqhlygpetlrqvtqhaehvvnalnteaklpcklvlkplgttpdei
    taicrdanyddrcaglvvwlhtfspakmwingltmlnkpllqfhtqfnaalpwdsidmdf
    mnlnqtahggrefgfigarmrqqhavvtghwqdkqaherigswmrqavskqdtrhlkvcr
    fgdnmrevavtdgdkvaaqikfgfsvntwavgdlvqvvnsisdgdvnalvdeyescytmt
    patqihgekrqnvleaarielgmkrfleqggfhaftttfedlhglkqlpglavqrlmqqg
    ygfagegdwktaallrimkvmstglqggtsfmedytyhfekgndlvlgshmlevcpsiav
    eekpildvqhlgiggkddparlifntqtgpaivaslidlgdryrllvncidtvktphslp
    klpvanalwkaqpdlptaseawilaggahhtvfshalnlndmrqfaemhdieitvidndt
    rlpafkdalrwnevyygfrr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4f2dB (B:)
    mtifdnyevwfvigsqhlygpetlrqvtqhaehvvnalnteaklpcklvlkplgttpdei
    taicrdanyddrcaglvvwlhtfspakmwingltmlnkpllqfhtqfnaalpwdsidmdf
    mnlnqtahggrefgfigarmrqqhavvtghwqdkqaherigswmrqavskqdtrhlkvcr
    fgdnmrevavtdgdkvaaqikfgfsvntwavgdlvqvvnsisdgdvnalvdeyescytmt
    patqihgekrqnvleaarielgmkrfleqggfhaftttfedlhglkqlpglavqrlmqqg
    ygfagegdwktaallrimkvmstglqggtsfmedytyhfekgndlvlgshmlevcpsiav
    eekpildvqhlgiggkddparlifntqtgpaivaslidlgdryrllvncidtvktphslp
    klpvanalwkaqpdlptaseawilaggahhtvfshalnlndmrqfaemhdieitvidndt
    rlpafkdalrwnevyygf
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4f2dC (C:)
    mtifdnyevwfvigsqhlygpetlrqvtqhaehvvnalnteaklpcklvlkplgttpdei
    taicrdanyddrcaglvvwlhtfspakmwingltmlnkpllqfhtqfnaalpwdsidmdf
    mnlnqtahggrefgfigarmrqqhavvtghwqdkqaherigswmrqavskqdtrhlkvcr
    fgdnmrevavtdgdkvaaqikfgfsvntwavgdlvqvvnsisdgdvnalvdeyescytmt
    patqihgekrqnvleaarielgmkrfleqggfhaftttfedlhglkqlpglavqrlmqqg
    ygfagegdwktaallrimkvmstglqggtsfmedytyhfekgndlvlgshmlevcpsiav
    eekpildvqhlgiggkddparlifntqtgpaivaslidlgdryrllvncidtvktphslp
    klpvanalwkaqpdlptaseawilaggahhtvfshalnlndmrqfaemhdieitvidndt
    rlpafkdalrwnevyygfrr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4f2dC (C:)
    mtifdnyevwfvigsqhlygpetlrqvtqhaehvvnalnteaklpcklvlkplgttpdei
    taicrdanyddrcaglvvwlhtfspakmwingltmlnkpllqfhtqfnaalpwdsidmdf
    mnlnqtahggrefgfigarmrqqhavvtghwqdkqaherigswmrqavskqdtrhlkvcr
    fgdnmrevavtdgdkvaaqikfgfsvntwavgdlvqvvnsisdgdvnalvdeyescytmt
    patqihgekrqnvleaarielgmkrfleqggfhaftttfedlhglkqlpglavqrlmqqg
    ygfagegdwktaallrimkvmstglqggtsfmedytyhfekgndlvlgshmlevcpsiav
    eekpildvqhlgiggkddparlifntqtgpaivaslidlgdryrllvncidtvktphslp
    klpvanalwkaqpdlptaseawilaggahhtvfshalnlndmrqfaemhdieitvidndt
    rlpafkdalrwnevyygf