PDB entry 4f25

View 4f25 on RCSB PDB site
Description: Crystal structure of the second RRM domain of human PABPC1 at pH 6.0
Class: translation
Keywords: RRM fold, Translation initiation, RNA-binding, eIF4G-binding, TRANSLATION
Deposited on 2012-05-07, released 2012-08-08
The last revision prior to the SCOPe 2.08 freeze date was dated 2013-01-02, with a file datestamp of 2012-12-28.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.219
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: polyadenylate-binding protein 1
    Species: Homo sapiens [TaxId:9606]
    Gene: PABPC1, PAB1, PABP1, PABPC2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P11940 (5-End)
      • expression tag (4)
    Domains in SCOPe 2.08: d4f25a1, d4f25a2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4f25A (A:)
    gplgsgnifiknldksidnkalydtfsafgnilsckvvcdengskgygfvhfetqeaaer
    aiekmngmllndrkvfvgrfksrkereaelgarakeftnvyiknfgpgstraaas
    

    Sequence, based on observed residues (ATOM records): (download)
    >4f25A (A:)
    sgnifiknldksidnkalydtfsafgnilsckvvcdengskgygfvhfetqeaaeraiek
    mngmllndrkvfvgrfksrke