PDB entry 4f23

View 4f23 on RCSB PDB site
Description: Influenza A virus hemagglutinin H16 HA0 structure with an alpha-helix conformation in the cleavage site: a potential drug target
Class: viral protein
Keywords: hemagglutinin, sialic acid, glycolysation, membrane, VIRAL PROTEIN
Deposited on 2012-05-07, released 2012-11-21
The last revision prior to the SCOPe 2.05 freeze date was dated 2012-11-21, with a file datestamp of 2012-11-16.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.161
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hemagglutinin
    Species: Influenza A virus [TaxId:304362]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5DL24 (11-509)
      • see remark 999 (6-10)
      • see remark 999 (510-514)
    Domains in SCOPe 2.05: d4f23a1
  • Chain 'B':
    Compound: Hemagglutinin
    Species: Influenza A virus [TaxId:304362]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5DL24 (11-509)
      • see remark 999 (6-10)
      • see remark 999 (510-514)
    Domains in SCOPe 2.05: d4f23b1
  • Chain 'C':
    Compound: Hemagglutinin
    Species: Influenza A virus [TaxId:304362]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5DL24 (11-509)
      • see remark 999 (6-10)
      • see remark 999 (510-514)
    Domains in SCOPe 2.05: d4f23c1
  • Heterogens: NAG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4f23A (A:)
    hhhhhhadgiqdkicigylsnnstdtvdtltengvpvtssidlvetnhtgtycslngvsp
    ihlgdcsfegwivgnpscasninirewsyliedpnaphklcfpgevdnngelrhlfsgvn
    sfsrtelippskwgdilegttascqnrgansfyrnliwlvnklnkypvvkgeynnttgrd
    vlvlwgihhpdteatanklyvnknpytlvstkewsrryeleigtrigdgqrswmkiywhl
    mhpgeritfessggllaprygyiiekygtgrifqsgvrlakcntkcqtsmggintnktfq
    niernalgdcpkyiksgqlklatglrnvpsiverglfgaiagfieggwpglingwygfqh
    qneqgtgiaadktstqkaineittkinniiekmngnydsirgefnqvekrinmiadrvdd
    avtdiwsynakllvliendrtldlhdanvrnlheqikralkdnaidegdgcfsilhkcnd
    scmetirngtynhedykeesqlkrqeiegirlvpr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4f23A (A:)
    adgiqdkicigylsnnstdtvdtltengvpvtssidlvetnhtgtycslngvspihlgdc
    sfegwivgnpscasninirewsyliedpnaphklcfpgevdnngelrhlfsgvnsfsrte
    lippskwgdilegttascqnrgansfyrnliwlvnklnkypvvkgeynnttgrdvlvlwg
    ihhpdteatanklyvnknpytlvstkewsrryeleigtrigdgqrswmkiywhlmhpger
    itfessggllaprygyiiekygtgrifqsgvrlakcntkcqtsmggintnktfqnierna
    lgdcpkyiksgqlklatglrnvpsiverglfgaiagfieggwpglingwygfqhqneqgt
    giaadktstqkaineittkinniiekmngnydsirgefnqvekrinmiadrvddavtdiw
    synakllvliendrtldlhdanvrnlheqikralkdnaidegdgcfsilhkcndscmeti
    rngtynhedykeesqlkrqeiegirlvpr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4f23B (B:)
    hhhhhhadgiqdkicigylsnnstdtvdtltengvpvtssidlvetnhtgtycslngvsp
    ihlgdcsfegwivgnpscasninirewsyliedpnaphklcfpgevdnngelrhlfsgvn
    sfsrtelippskwgdilegttascqnrgansfyrnliwlvnklnkypvvkgeynnttgrd
    vlvlwgihhpdteatanklyvnknpytlvstkewsrryeleigtrigdgqrswmkiywhl
    mhpgeritfessggllaprygyiiekygtgrifqsgvrlakcntkcqtsmggintnktfq
    niernalgdcpkyiksgqlklatglrnvpsiverglfgaiagfieggwpglingwygfqh
    qneqgtgiaadktstqkaineittkinniiekmngnydsirgefnqvekrinmiadrvdd
    avtdiwsynakllvliendrtldlhdanvrnlheqikralkdnaidegdgcfsilhkcnd
    scmetirngtynhedykeesqlkrqeiegirlvpr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4f23B (B:)
    adgiqdkicigylsnnstdtvdtltengvpvtssidlvetnhtgtycslngvspihlgdc
    sfegwivgnpscasninirewsyliedpnaphklcfpgevdnngelrhlfsgvnsfsrte
    lippskwgdilegttascqnrgansfyrnliwlvnklnkypvvkgeynnttgrdvlvlwg
    ihhpdteatanklyvnknpytlvstkewsrryeleigtrigdgqrswmkiywhlmhpger
    itfessggllaprygyiiekygtgrifqsgvrlakcntkcqtsmggintnktfqnierna
    lgdcpkyiksgqlklatglrnvpsiverglfgaiagfieggwpglingwygfqhqneqgt
    giaadktstqkaineittkinniiekmngnydsirgefnqvekrinmiadrvddavtdiw
    synakllvliendrtldlhdanvrnlheqikralkdnaidegdgcfsilhkcndscmeti
    rngtynhedykeesqlkrqeiegirlvpr
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4f23C (C:)
    hhhhhhadgiqdkicigylsnnstdtvdtltengvpvtssidlvetnhtgtycslngvsp
    ihlgdcsfegwivgnpscasninirewsyliedpnaphklcfpgevdnngelrhlfsgvn
    sfsrtelippskwgdilegttascqnrgansfyrnliwlvnklnkypvvkgeynnttgrd
    vlvlwgihhpdteatanklyvnknpytlvstkewsrryeleigtrigdgqrswmkiywhl
    mhpgeritfessggllaprygyiiekygtgrifqsgvrlakcntkcqtsmggintnktfq
    niernalgdcpkyiksgqlklatglrnvpsiverglfgaiagfieggwpglingwygfqh
    qneqgtgiaadktstqkaineittkinniiekmngnydsirgefnqvekrinmiadrvdd
    avtdiwsynakllvliendrtldlhdanvrnlheqikralkdnaidegdgcfsilhkcnd
    scmetirngtynhedykeesqlkrqeiegirlvpr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4f23C (C:)
    adgiqdkicigylsnnstdtvdtltengvpvtssidlvetnhtgtycslngvspihlgdc
    sfegwivgnpscasninirewsyliedpnaphklcfpgevdnngelrhlfsgvnsfsrte
    lippskwgdilegttascqnrgansfyrnliwlvnklnkypvvkgeynnttgrdvlvlwg
    ihhpdteatanklyvnknpytlvstkewsrryeleigtrigdgqrswmkiywhlmhpger
    itfessggllaprygyiiekygtgrifqsgvrlakcntkcqtsmggintnktfqnierna
    lgdcpkyiksgqlklatglrnvpsiverglfgaiagfieggwpglingwygfqhqneqgt
    giaadktstqkaineittkinniiekmngnydsirgefnqvekrinmiadrvddavtdiw
    synakllvliendrtldlhdanvrnlheqikralkdnaidegdgcfsilhkcndscmeti
    rngtynhedykeesqlkrqeiegirlvpr