PDB entry 4f21

View 4f21 on RCSB PDB site
Description: Crystal structure of carboxylesterase/phospholipase family protein from Francisella tularensis
Class: hydrolase/hydrolase inhibitor
Keywords: Structural Genomics, NIAID, National Institute of Allergy and Infectious Diseases, Center for Structural Genomics of Infectious Diseases, CSGID, carboxylesterase, phospholipase, HYDROLASE-HYDROLASE INHIBITOR complex
Deposited on 2012-05-07, released 2012-08-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-15, with a file datestamp of 2017-11-10.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Carboxylesterase/phospholipase family protein
    Species: Francisella tularensis subsp. tularensis [TaxId:177416]
    Gene: FTT_0258
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5NI32 (24-245)
      • expression tag (22-23)
    Domains in SCOPe 2.07: d4f21a1, d4f21a2
  • Chain 'B':
    Compound: Carboxylesterase/phospholipase family protein
    Species: Francisella tularensis subsp. tularensis [TaxId:177416]
    Gene: FTT_0258
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5NI32 (24-245)
      • expression tag (22-23)
    Domains in SCOPe 2.07: d4f21b1, d4f21b2
  • Chain 'C':
    Compound: Carboxylesterase/phospholipase family protein
    Species: Francisella tularensis subsp. tularensis [TaxId:177416]
    Gene: FTT_0258
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5NI32 (24-245)
      • expression tag (22-23)
    Domains in SCOPe 2.07: d4f21c1, d4f21c2
  • Chain 'D':
    Compound: Carboxylesterase/phospholipase family protein
    Species: Francisella tularensis subsp. tularensis [TaxId:177416]
    Gene: FTT_0258
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5NI32 (24-245)
      • expression tag (22-23)
    Domains in SCOPe 2.07: d4f21d1, d4f21d2
  • Chain 'E':
    Compound: Carboxylesterase/phospholipase family protein
    Species: Francisella tularensis subsp. tularensis [TaxId:177416]
    Gene: FTT_0258
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5NI32 (24-245)
      • expression tag (21-23)
    Domains in SCOPe 2.07: d4f21e1, d4f21e2
  • Chain 'F':
    Compound: Carboxylesterase/phospholipase family protein
    Species: Francisella tularensis subsp. tularensis [TaxId:177416]
    Gene: FTT_0258
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5NI32 (24-245)
      • expression tag (21-23)
    Domains in SCOPe 2.07: d4f21f1, d4f21f2
  • Chain 'G':
    Compound: Carboxylesterase/phospholipase family protein
    Species: Francisella tularensis subsp. tularensis [TaxId:177416]
    Gene: FTT_0258
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5NI32 (24-245)
      • expression tag (21-23)
    Domains in SCOPe 2.07: d4f21g1, d4f21g2
  • Chain 'H':
    Compound: Carboxylesterase/phospholipase family protein
    Species: Francisella tularensis subsp. tularensis [TaxId:177416]
    Gene: FTT_0258
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5NI32 (24-245)
      • expression tag (21-23)
    Domains in SCOPe 2.07: d4f21h1, d4f21h2
  • Heterogens: 0S1, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4f21A (A:)
    mhhhhhhssgvdlgtenlyfqsnamnyelmepakqarfcviwlhglgadghdfvdivnyf
    dvsldeirfifphadiipvtinmgmqmrawydiksldanslnrvvdveginssiakvnkl
    idsqvnqgiaseniilagfsqggiiatytaitsqrklggimalstylpawdnfkgkitsi
    nkglpilvchgtddqvlpevlghdlsdklkvsgfaneykhyvgmqhsvcmeeikdisnfi
    aktfki
    

    Sequence, based on observed residues (ATOM records): (download)
    >4f21A (A:)
    namnyelmepakqarfcviwlhgadghdfvdivnyfdvsldeirfifphadiipvtinmg
    mqmrawydikslslnrvvdveinssiakvnklidsqvnqiaseniilagfsqggiiatyt
    aitsqrklggimalstylpawdnfkgkitsinkglpilvchgtddqvlpevlghdlsdkl
    kvsgfaneykhyvgmqhsvcmeeikdisnfiaktfki
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4f21B (B:)
    mhhhhhhssgvdlgtenlyfqsnamnyelmepakqarfcviwlhglgadghdfvdivnyf
    dvsldeirfifphadiipvtinmgmqmrawydiksldanslnrvvdveginssiakvnkl
    idsqvnqgiaseniilagfsqggiiatytaitsqrklggimalstylpawdnfkgkitsi
    nkglpilvchgtddqvlpevlghdlsdklkvsgfaneykhyvgmqhsvcmeeikdisnfi
    aktfki
    

    Sequence, based on observed residues (ATOM records): (download)
    >4f21B (B:)
    namnyelmepakqarfcviwlhgadghdfvdivnyfdvsldeirfifphadiipvtinmg
    mqmrawydiksldslnrvvdveginssiakvnklidsqvnqgiaseniilagfsqggiia
    tytaitsqrklggimalstylpawdnfkgkitsinkglpilvchgtddqvlpevlghdls
    dklkvsgfaneykhyvgmqhsvcmeeikdisnfiaktfki
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4f21C (C:)
    mhhhhhhssgvdlgtenlyfqsnamnyelmepakqarfcviwlhglgadghdfvdivnyf
    dvsldeirfifphadiipvtinmgmqmrawydiksldanslnrvvdveginssiakvnkl
    idsqvnqgiaseniilagfsqggiiatytaitsqrklggimalstylpawdnfkgkitsi
    nkglpilvchgtddqvlpevlghdlsdklkvsgfaneykhyvgmqhsvcmeeikdisnfi
    aktfki
    

    Sequence, based on observed residues (ATOM records): (download)
    >4f21C (C:)
    namnyelmepakqarfcviwlhgadghdfvdivnyfdvsldeirfifphadiipvtinmg
    mqmrawydiksldslnrvvdveginssiakvnklidsqvnqgiaseniilagfsqggiia
    tytaitsqrklggimalstylpawdnfkgkitsinkglpilvchgtddqvlpevlghdls
    dklkvsgfaneykhyvgmqhsvcmeeikdisnfiaktfki
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4f21D (D:)
    mhhhhhhssgvdlgtenlyfqsnamnyelmepakqarfcviwlhglgadghdfvdivnyf
    dvsldeirfifphadiipvtinmgmqmrawydiksldanslnrvvdveginssiakvnkl
    idsqvnqgiaseniilagfsqggiiatytaitsqrklggimalstylpawdnfkgkitsi
    nkglpilvchgtddqvlpevlghdlsdklkvsgfaneykhyvgmqhsvcmeeikdisnfi
    aktfki
    

    Sequence, based on observed residues (ATOM records): (download)
    >4f21D (D:)
    namnyelmepakqarfcviwlhgadghdfvdivnyfdvsldeirfifphadiipvtinmg
    mqmrawydiksldslnrvvdveginssiakvnklidsqvnqgiaseniilagfsqggiia
    tytaitsqrklggimalstylpawdnfkgkitsinkglpilvchgtddqvlpevlghdls
    dklkvsgfaneykhyvgmqhsvcmeeikdisnfiaktfki
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4f21E (E:)
    mhhhhhhssgvdlgtenlyfqsnamnyelmepakqarfcviwlhglgadghdfvdivnyf
    dvsldeirfifphadiipvtinmgmqmrawydiksldanslnrvvdveginssiakvnkl
    idsqvnqgiaseniilagfsqggiiatytaitsqrklggimalstylpawdnfkgkitsi
    nkglpilvchgtddqvlpevlghdlsdklkvsgfaneykhyvgmqhsvcmeeikdisnfi
    aktfki
    

    Sequence, based on observed residues (ATOM records): (download)
    >4f21E (E:)
    snamnyelmepakqarfcviwlhglghdfvdivnyfdvsldeirfifphadigmqmrawy
    diksvdveginssiakvnklidsqvnqgiaseniilagfsqggiiatytaitsqrklggi
    malstylpawdnfkgkitsinkglpilvchgtddqvlpevlghdlsdklkvsgfaneykh
    yvgmqhsvcmeeikdisnfiaktfki
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >4f21F (F:)
    mhhhhhhssgvdlgtenlyfqsnamnyelmepakqarfcviwlhglgadghdfvdivnyf
    dvsldeirfifphadiipvtinmgmqmrawydiksldanslnrvvdveginssiakvnkl
    idsqvnqgiaseniilagfsqggiiatytaitsqrklggimalstylpawdnfkgkitsi
    nkglpilvchgtddqvlpevlghdlsdklkvsgfaneykhyvgmqhsvcmeeikdisnfi
    aktfki
    

    Sequence, based on observed residues (ATOM records): (download)
    >4f21F (F:)
    snamnyelmepakqarfcviwlhglghdfvdivnyfdvsldeirfifphadimgmqmraw
    ydiksveginssiakvnklidsqvnqgiaseniilagfsqggiiatytaitsqrklggim
    alstylpawdnfkgkitsinkglpilvchgtddqvlpevlghdlsdklkvsgfaneykhy
    vgmqhsvcmeeikdisnfiaktfki
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >4f21G (G:)
    mhhhhhhssgvdlgtenlyfqsnamnyelmepakqarfcviwlhglgadghdfvdivnyf
    dvsldeirfifphadiipvtinmgmqmrawydiksldanslnrvvdveginssiakvnkl
    idsqvnqgiaseniilagfsqggiiatytaitsqrklggimalstylpawdnfkgkitsi
    nkglpilvchgtddqvlpevlghdlsdklkvsgfaneykhyvgmqhsvcmeeikdisnfi
    aktfki
    

    Sequence, based on observed residues (ATOM records): (download)
    >4f21G (G:)
    snamnyelmepakqarfcviwlhhdfvdivnyfdvsldeirfifphaipvtigmqmrawy
    dikvvdveginssikvnklidsqvnqgiaseniilagfsqggiiatytaitsqrklggim
    alstylpawdnkgkitsinkglpilvchgtddqvlpevlghdlsdklkvsgfaneykhyv
    gmqhsvcmeeikdisnfiaktfki
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >4f21H (H:)
    mhhhhhhssgvdlgtenlyfqsnamnyelmepakqarfcviwlhglgadghdfvdivnyf
    dvsldeirfifphadiipvtinmgmqmrawydiksldanslnrvvdveginssiakvnkl
    idsqvnqgiaseniilagfsqggiiatytaitsqrklggimalstylpawdnfkgkitsi
    nkglpilvchgtddqvlpevlghdlsdklkvsgfaneykhyvgmqhsvcmeeikdisnfi
    aktfki
    

    Sequence, based on observed residues (ATOM records): (download)
    >4f21H (H:)
    snamnyelmepakqarfcviwlhghdfvdivnyfdvsldeirfifphaipvtimrawydi
    kvvdveginssiakvnklidsqvnqgiaseniilagfsqggiiatytaitsqrklggima
    lstylpawdnfkgkitsinkglpilvchgtddqvlpevlghdlsdklkvsgfaneykhyv
    gmqhsvcmeeikdisnfiaktfki