PDB entry 4f0z

View 4f0z on RCSB PDB site
Description: Crystal Structure of Calcineurin in Complex with the Calcineurin-Inhibiting Domain of the African Swine Fever Virus Protein A238L
Class: hydrolase/protein binding
Keywords: EF-hand, phosphatase, PxIxIT, LxVP, calcium signaling, transcription regulation, T-cell activation, Calcineurin inhibition, calmodulin, RCAN, NFAT, heart, nucleus, skeletal muscle, ion channels, hydrolase-protein binding complex
Deposited on 2012-05-05, released 2013-03-06
The last revision prior to the SCOPe 2.06 freeze date was dated 2013-03-27, with a file datestamp of 2013-03-22.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.158
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Serine/threonine-protein phosphatase 2B catalytic subunit alpha isoform
    Species: Homo sapiens [TaxId:9606]
    Gene: PPP3CA, CALNA, CNA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4f0za_
  • Chain 'B':
    Compound: Calcineurin subunit B type 1
    Species: Homo sapiens [TaxId:9606]
    Gene: PPP3R1, CNA2, CNB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4f0zb_
  • Chain 'C':
    Compound: Ankyrin repeat domain-containing protein A238L
    Species: African swine fever virus Malawi LIL 20/1 [TaxId:10500]
    Gene: 5EL, Mal-047, Ordered Locus Name: Mal-047 ORF Name: 5EL
    Database cross-references and differences (RAF-indexed):
  • Heterogens: GOL, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4f0zA (A:)
    ghmsepkaidpklsttdrvvkavpfppshrltakevfdndgkprvdilkahlmkegrlee
    svalriitegasilrqeknlldidapvtvcgdihgqffdlmklfevggspantrylflgd
    yvdrgyfsiecvlylwalkilypktlfllrgnhecrhlteyftfkqeckikyservydac
    mdafdclplaalmnqqflcvhgglspeintlddirkldrfkeppaygpmcdilwsdpled
    fgnektqehfthntvrgcsyfysypavceflqhnnllsilraheaqdagyrmyrksqttg
    fpslitifsapnyldvynnkaavlkyennvmnirqfncsphpywlpnfmdvftwslpfvg
    ekvtemlvnvln
    

    Sequence, based on observed residues (ATOM records): (download)
    >4f0zA (A:)
    tdrvvkavpfppshrltakevfdndgkprvdilkahlmkegrleesvalriitegasilr
    qeknlldidapvtvcgdihgqffdlmklfevggspantrylflgdyvdrgyfsiecvlyl
    walkilypktlfllrgnhecrhlteyftfkqeckikyservydacmdafdclplaalmnq
    qflcvhgglspeintlddirkldrfkeppaygpmcdilwsdpledfgnektqehfthntv
    rgcsyfysypavceflqhnnllsilraheaqdagyrmyrksqttgfpslitifsapnyld
    vynnkaavlkyennvmnirqfncsphpywlpnfmdvftwslpfvgekvtemlvnvln
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4f0zB (B:)
    mgneasyplemcshfdadeikrlgkrfkkldldnsgslsveefmslpelqqnplvqrvid
    ifdtdgngevdfkefiegvsqfsvkgdkeqklrfafriydmdkdgyisngelfqvlkmmv
    gnnlkdtqlqqivdktiinadkdgdgrisfeefcavvggldihkkmvvdv
    

    Sequence, based on observed residues (ATOM records): (download)
    >4f0zB (B:)
    yplemcshfdadeikrlgkrfkkldldnsgslsveefmslpelqqnplvqrvidifdtdg
    ngevdfkefiegvsqfsvkgdkeqklrfafriydmdkdgyisngelfqvlkmmvgnnlkd
    tqlqqivdktiinadkdgdgrisfeefcavvggld
    

  • Chain 'C':
    No sequence available.