PDB entry 4f0h

View 4f0h on RCSB PDB site
Description: UNACTIVATED RUBISCO with OXYGEN BOUND
Class: lyase
Keywords: alpha beta domain, catalytic domain tim barrel, carboxylase/oxygenase, nitrosylation, chloroplast, lyase
Deposited on 2012-05-04, released 2012-11-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-12-12, with a file datestamp of 2012-12-07.
Experiment type: XRAY
Resolution: 1.96 Å
R-factor: 0.166
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ribulose bisphosphate carboxylase large chain
    Species: Galdieria sulphuraria [TaxId:130081]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4f0ha1, d4f0ha2
  • Chain 'B':
    Compound: ribulose bisphosphate carboxylase small chain
    Species: Galdieria sulphuraria [TaxId:130081]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4f0hb_
  • Heterogens: OXY, PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4f0hA (A:)
    msqsleeksvqertriknsryesgvipyakmgywnpdyqvkdtdvlalfrvtpqpgvdpi
    eaaaavagesstatwtvvwtdlltaadlyrakaykvdqvpnnpeqyfayiayeldlfeeg
    sianltasiignvfgfkavkalrledmrlpfayiktfqgpatgvilererldkfgrpllg
    cttkpklglsgknygrvvyealkggldfvkddeninsqpfmrwrerylfvmeavnkaaaa
    tgevkghylnvtaatmeemyaraqlakelgsviimidlvigytaiqtmakwardndmilh
    lhragnstysrqknhgmnfrvickwmrmagvdhihagtvvgklegdpiitrgfyktlllp
    klernlqeglffdmdwaslrkvmpvasggihagqmhqlihylgedvvlqfgggtighpdg
    iqsgatanrvaleamilarnenrdfltegpeilreaakncgalrtaldlwkditfnytst
    dtsdfvetptani
    

    Sequence, based on observed residues (ATOM records): (download)
    >4f0hA (A:)
    pyakmgywnpdyqvkdtdvlalfrvtpqpgvdpieaaaavagesstatwtvvwtdlltaa
    dlyrakaykvdqvpnnpeqyfayiayeldlfeegsianltasiignvfgfkavkalrled
    mrlpfayiktfqgpatgvilererldkfgrpllgcttkpklglsgknygrvvyealkggl
    dfvkddeninsqpfmrwrerylfvmeavnkaaaatgevkghylnvtaatmeemyaraqla
    kelgsviimidlvigytaiqtmakwardndmilhlhragnstysrqknhgmnfrvickwm
    rmagvdhihagtvvgklegdpiitrgfyktlllpklernlqeglffdmdwaslrkvmpva
    sggihagqmhqlihylgedvvlqfgggtighpdgiqsgatanrvaleamilarnenrdfl
    tegpeilreaakncgalrtaldlwkdit
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4f0hB (B:)
    mritqgtfsflpdltdeqikkqidymiskklaigieytndihprnsfwemwglplfevtd
    papvlfeinacrkaksnfyikvvgfssergiestiisfivnrpkhepgfnlirqedksrs
    ikysiqayetykpedqry