PDB entry 4f04

View 4f04 on RCSB PDB site
Description: A Second Allosteric site in E. coli Aspartate Transcarbamoylase: R-state ATCase with UTP bound
Class: transferase
Keywords: Allosteric Regulation, ATCase, TRANSFERASE
Deposited on 2012-05-03, released 2012-07-11
The last revision prior to the SCOPe 2.06 freeze date was dated 2013-06-26, with a file datestamp of 2013-06-21.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.175
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Aspartate carbamoyltransferase catalytic chain
    Species: Escherichia coli [TaxId:83333]
    Gene: b4245, JW4204, pyrB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4f04a1, d4f04a2
  • Chain 'B':
    Compound: Aspartate carbamoyltransferase regulatory chain
    Species: Escherichia coli [TaxId:83333]
    Gene: b4244, JW4203, pyrI
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4f04b1, d4f04b2
  • Chain 'C':
    Compound: Aspartate carbamoyltransferase catalytic chain
    Species: Escherichia coli [TaxId:83333]
    Gene: b4245, JW4204, pyrB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4f04c1, d4f04c2
  • Chain 'D':
    Compound: Aspartate carbamoyltransferase regulatory chain
    Species: Escherichia coli [TaxId:83333]
    Gene: b4244, JW4203, pyrI
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4f04d1, d4f04d2
  • Heterogens: PAL, ZN, UTP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4f04A (A:)
    anplyqkhiisindlsrddlnlvlataaklkanpqpellkhkviascffeastrtrlsfe
    tsmhrlgasvvgfsdsantslgkkgetladtisvistyvdaivmrhpqegaarlatefsg
    nvpvlnagdgsnqhptqtlldlftiqetqgrldnlhvamvgdlkygrtvhsltqalakfd
    gnrfyfiapdalampqyildmldekgiawslhssieevmaevdilymtrvqkerldpsey
    anvkaqfvlrasdlhnakanmkvlhplprvdeiatdvdktphawyfqqagngifarqall
    alvlnrdlvl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4f04B (B:)
    mthdnklqveaikrgtvidhipaqigfkllslfkltetdqritiglnlpsgemgrkdlik
    ientflsedqvdqlalyapqatvnridnyevvgksrpslperidnvlvcpnsncishaep
    vsssfavrkrandialkckycekefshnvvlan
    

    Sequence, based on observed residues (ATOM records): (download)
    >4f04B (B:)
    aikrgtvidhipaqigfkllslfkltetdqritiglnlpsgemgrkdlikientflsedq
    vdqlalyapqatvnridnyevvgksrpslperidnvlvcpnsncishaepvsssfavrkr
    andialkckycekefshnvvlan
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4f04C (C:)
    anplyqkhiisindlsrddlnlvlataaklkanpqpellkhkviascffeastrtrlsfe
    tsmhrlgasvvgfsdsantslgkkgetladtisvistyvdaivmrhpqegaarlatefsg
    nvpvlnagdgsnqhptqtlldlftiqetqgrldnlhvamvgdlkygrtvhsltqalakfd
    gnrfyfiapdalampqyildmldekgiawslhssieevmaevdilymtrvqkerldpsey
    anvkaqfvlrasdlhnakanmkvlhplprvdeiatdvdktphawyfqqagngifarqall
    alvlnrdlvl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4f04D (D:)
    mthdnklqveaikrgtvidhipaqigfkllslfkltetdqritiglnlpsgemgrkdlik
    ientflsedqvdqlalyapqatvnridnyevvgksrpslperidnvlvcpnsncishaep
    vsssfavrkrandialkckycekefshnvvlan
    

    Sequence, based on observed residues (ATOM records): (download)
    >4f04D (D:)
    aikrgtvidhipaqigfkllslfkltetdqritiglnlpsgemgrkdlikientflsedq
    vdqlalyapqatvnridnyevvgksrpslperidnvlvcpnsncishaepvsssfavrkr
    andialkckycekefshnvvlan