PDB entry 4f01

View 4f01 on RCSB PDB site
Description: Crystal structure of an artificial dimeric DnaK complex
Class: chaperone
Keywords: chaperone
Deposited on 2012-05-03, released 2013-04-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-15, with a file datestamp of 2017-11-10.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: N/A
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Chaperone protein dnaK
    Species: Escherichia coli [TaxId:83333]
    Gene: b0014, dnaK, groP, grpF, JW0013, seg
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A6Y8 (22-End)
      • expression tag (18-21)
    Domains in SCOPe 2.07: d4f01a1, d4f01a2, d4f01a3
  • Chain 'B':
    Compound: Chaperone protein dnaK
    Species: Escherichia coli [TaxId:83333]
    Gene: b0014, dnaK, groP, grpF, JW0013, seg
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A6Y8 (22-End)
      • expression tag (6-12)
      • expression tag (15-21)
    Domains in SCOPe 2.07: d4f01b1, d4f01b2, d4f01b3
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4f01A (A:)
    mghhhhhhhhhhssghiegrhmvllldvtplslgietmggvmttliaknttiptkhsqvf
    staednqsavtihvlqgerkraadnkslgqfnldginpaprgmpqievtfdidadgilhv
    sakdknsgkeqkitikassglnedeiqkmvrdaeanaeadrkfeelvqtrnqgdhllhst
    rkqveeagdklpaddktaiesaltaletalkgedkaaieakmqelaqvsqklmeiaqqqh
    a
    

    Sequence, based on observed residues (ATOM records): (download)
    >4f01A (A:)
    grhmvllldvtplslgietmggvmttliaknttiptkhsqvfstaednqsavtihvlqge
    rkraadnkslgqfnldginpaprgmpqievtfdidadgilhvsakdknsgkeqkitikas
    sglnedeiqkmvrdaeanaeadrkfeelvqtrnqgdhllhstrkqveeagdklpaddkta
    iesaltaletalkgedkaaieakmqelaqvsqklmeia
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4f01B (B:)
    mghhhhhhhhhhssghiegrhmvllldvtplslgietmggvmttliaknttiptkhsqvf
    staednqsavtihvlqgerkraadnkslgqfnldginpaprgmpqievtfdidadgilhv
    sakdknsgkeqkitikassglnedeiqkmvrdaeanaeadrkfeelvqtrnqgdhllhst
    rkqveeagdklpaddktaiesaltaletalkgedkaaieakmqelaqvsqklmeiaqqqh
    a
    

    Sequence, based on observed residues (ATOM records): (download)
    >4f01B (B:)
    hhhhhhshiegrhmvllldvtplslgietmggvmttliaknttiptkhsqvfstaednqs
    avtihvlqgerkraadnkslgqfnldginpaprgmpqievtfdidadgilhvsakdknsg
    keqkitikassglnedeiqkmvrdaeanaeadrkfeelvqtrnqgdhllhstrkqveeag
    dklpaddktaiesaltaletalkgedkaaieakmqelaqvsqklmeiaqq