PDB entry 4ez5

View 4ez5 on RCSB PDB site
Description: CDK6 (monomeric) in complex with inhibitor
Class: transferase/transferase inhibitor
Keywords: Protein Kinase, ATP Binding, TRANSFERASE-TRANSFERASE INHIBITOR complex
Deposited on 2012-05-02, released 2013-02-06
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-09-24, with a file datestamp of 2014-09-19.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.22
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cyclin-dependent kinase 6
    Species: Homo sapiens [TaxId:9606]
    Gene: CDK6, CDKN6
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4ez5a_
  • Heterogens: 0RS

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4ez5A (A:)
    mekdglcradqqyecvaeigegaygkvfkardlknggrfvalkrvrvqtgeegmplstir
    evavlrhletfehpnvvrlfdvctvsrtdretkltlvfehvdqdlttyldkvpepgvpte
    tikdmmfqllrgldflhshrvvhrdlkpqnilvtssgqikladfglariysfqmaltsvv
    vtlwyrapevllqssyatpvdlwsvgcifaemfrrkplfrgssdvdqlgkildviglpge
    edwprdvalprqafhsksaqpiekfvtdidelgkdlllkcltfnpakrisaysalshpyf
    qhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ez5A (A:)
    qqyecvaeigegagkvfkardlknggrfvalkrvplstirevavlrhletfehpnvvrlf
    dvctkltlvfehvdqdlttyldkvpepgvptetikdmmfqllrgldflhshrvvhrdlkp
    qnilvtssgqikladfglavtlwyrapevllqssyatpvdlwsvgcifaemfrrkplfrg
    ssdvdqlgkildviglpgeedwprdvalprqafhsaqpiekfvtdidelgkdlllkcltf
    npakrisaysalshpyfq